Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F5S7

Protein Details
Accession A0A059F5S7    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-95VKTFFKRLISFKKKFKRNIKFMLIYDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MFIHFLLLSENFKKNIAALSEYMEHLNSVNKSYILGIIKDFFTISEENLRAINVFRENIITNRYFKNSSVKTFFKRLISFKKKFKRNIKFMLIYDSLFNFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.21
4 0.19
5 0.17
6 0.2
7 0.2
8 0.21
9 0.21
10 0.17
11 0.15
12 0.12
13 0.16
14 0.13
15 0.13
16 0.13
17 0.13
18 0.13
19 0.13
20 0.16
21 0.14
22 0.13
23 0.12
24 0.12
25 0.13
26 0.12
27 0.12
28 0.08
29 0.09
30 0.09
31 0.08
32 0.12
33 0.12
34 0.12
35 0.12
36 0.12
37 0.1
38 0.1
39 0.11
40 0.08
41 0.08
42 0.08
43 0.09
44 0.1
45 0.11
46 0.14
47 0.14
48 0.15
49 0.17
50 0.2
51 0.2
52 0.2
53 0.29
54 0.29
55 0.33
56 0.37
57 0.41
58 0.42
59 0.46
60 0.48
61 0.45
62 0.46
63 0.48
64 0.52
65 0.58
66 0.61
67 0.66
68 0.72
69 0.75
70 0.8
71 0.84
72 0.84
73 0.84
74 0.86
75 0.85
76 0.81
77 0.74
78 0.72
79 0.63
80 0.52
81 0.45