Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F1C8

Protein Details
Accession A0A059F1C8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-98KLEEETKEREKNRKKKKNSEEKKKKIKKTVEVNSEEIEAKNKKKSKKSSKKKEEPKEEKIKKTBasic
NLS Segment(s)
PositionSequence
42-99KEREKNRKKKKNSEEKKKKIKKTVEVNSEEIEAKNKKKSKKSSKKKEEPKEEKIKKTV
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MSCLSNFFSSIFRSCRREKEEETDTSPVNYLSEISKLEEETKEREKNRKKKKNSEEKKKKIKKTVEVNSEEIEAKNKKKSKKSSKKKEEPKEEKIKKTVVSKTKNKTIPSIEDSFFGSAEDHNYTPFQNKKLYLDQEIHLKEKNKYNSGFTDYSYIIDKYIVNPYDKIDHNHLQSKEISVMLKNKMEEYIKNNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.54
4 0.58
5 0.59
6 0.62
7 0.63
8 0.62
9 0.62
10 0.56
11 0.5
12 0.43
13 0.38
14 0.3
15 0.23
16 0.17
17 0.13
18 0.1
19 0.12
20 0.11
21 0.13
22 0.14
23 0.14
24 0.17
25 0.19
26 0.21
27 0.24
28 0.31
29 0.37
30 0.4
31 0.5
32 0.58
33 0.65
34 0.74
35 0.79
36 0.81
37 0.85
38 0.91
39 0.92
40 0.92
41 0.94
42 0.94
43 0.94
44 0.95
45 0.94
46 0.92
47 0.9
48 0.88
49 0.85
50 0.85
51 0.83
52 0.81
53 0.76
54 0.69
55 0.6
56 0.53
57 0.44
58 0.33
59 0.29
60 0.23
61 0.22
62 0.27
63 0.31
64 0.37
65 0.45
66 0.55
67 0.62
68 0.7
69 0.78
70 0.82
71 0.88
72 0.92
73 0.94
74 0.93
75 0.93
76 0.9
77 0.88
78 0.88
79 0.84
80 0.78
81 0.71
82 0.63
83 0.55
84 0.53
85 0.51
86 0.49
87 0.5
88 0.54
89 0.56
90 0.62
91 0.63
92 0.58
93 0.55
94 0.49
95 0.46
96 0.43
97 0.41
98 0.33
99 0.29
100 0.29
101 0.25
102 0.21
103 0.16
104 0.11
105 0.07
106 0.09
107 0.1
108 0.09
109 0.1
110 0.11
111 0.11
112 0.16
113 0.19
114 0.2
115 0.22
116 0.23
117 0.27
118 0.33
119 0.36
120 0.34
121 0.34
122 0.33
123 0.37
124 0.38
125 0.36
126 0.33
127 0.33
128 0.34
129 0.39
130 0.44
131 0.42
132 0.42
133 0.44
134 0.44
135 0.47
136 0.44
137 0.36
138 0.34
139 0.28
140 0.27
141 0.26
142 0.22
143 0.15
144 0.15
145 0.15
146 0.13
147 0.2
148 0.22
149 0.21
150 0.22
151 0.24
152 0.29
153 0.31
154 0.34
155 0.33
156 0.37
157 0.41
158 0.48
159 0.46
160 0.43
161 0.42
162 0.4
163 0.35
164 0.31
165 0.27
166 0.23
167 0.28
168 0.3
169 0.33
170 0.31
171 0.3
172 0.34
173 0.35
174 0.35
175 0.37