Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F672

Protein Details
Accession A0A059F672    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-23VADKTKEKKARIQRMLSKRLGPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8.333, nucl 8, mito_nucl 7.833, cyto 7.5, mito 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004585  DNA_recomb/repair_Rad52  
IPR041247  Rad52_fam  
IPR007232  Rad52_Rad59_Rad22  
IPR042525  Rad52_Rad59_Rad22_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000730  P:DNA recombinase assembly  
GO:0045002  P:double-strand break repair via single-strand annealing  
Pfam View protein in Pfam  
PF04098  Rad52_Rad22  
Amino Acid Sequences MVADKTKEKKARIQRMLSKRLGPEYISYRQGFNGMKLAYIEGWVAFSIANKIFGYDGWSSEVKSVTVDFCDDIPNKFSVGISVLVRVTLSDGTYKEDIGFGSSENQKSKVNAWEKAKKEAVTDAIKRALRQFGNALGNCCYDKLFLSEVQKFSKTTKKNIQEWDLMRKNDEDKNEVLSEGSSINLEGLDLSDNLTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.87
4 0.82
5 0.77
6 0.69
7 0.65
8 0.57
9 0.48
10 0.44
11 0.41
12 0.41
13 0.41
14 0.38
15 0.34
16 0.32
17 0.36
18 0.31
19 0.27
20 0.28
21 0.22
22 0.21
23 0.21
24 0.21
25 0.16
26 0.15
27 0.14
28 0.07
29 0.08
30 0.07
31 0.07
32 0.06
33 0.06
34 0.09
35 0.09
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.15
42 0.12
43 0.13
44 0.14
45 0.14
46 0.14
47 0.16
48 0.16
49 0.12
50 0.12
51 0.12
52 0.09
53 0.09
54 0.1
55 0.08
56 0.08
57 0.12
58 0.13
59 0.13
60 0.14
61 0.14
62 0.14
63 0.13
64 0.13
65 0.09
66 0.1
67 0.11
68 0.09
69 0.1
70 0.09
71 0.09
72 0.09
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.07
79 0.1
80 0.1
81 0.11
82 0.1
83 0.1
84 0.09
85 0.08
86 0.08
87 0.06
88 0.09
89 0.12
90 0.14
91 0.15
92 0.17
93 0.17
94 0.17
95 0.2
96 0.24
97 0.26
98 0.3
99 0.36
100 0.43
101 0.44
102 0.5
103 0.5
104 0.42
105 0.39
106 0.35
107 0.34
108 0.32
109 0.31
110 0.28
111 0.31
112 0.31
113 0.3
114 0.31
115 0.31
116 0.25
117 0.25
118 0.24
119 0.24
120 0.31
121 0.31
122 0.3
123 0.26
124 0.27
125 0.25
126 0.24
127 0.18
128 0.12
129 0.11
130 0.12
131 0.13
132 0.15
133 0.21
134 0.26
135 0.28
136 0.31
137 0.32
138 0.3
139 0.32
140 0.38
141 0.36
142 0.4
143 0.48
144 0.53
145 0.59
146 0.66
147 0.67
148 0.66
149 0.66
150 0.68
151 0.65
152 0.57
153 0.52
154 0.47
155 0.46
156 0.42
157 0.42
158 0.35
159 0.29
160 0.34
161 0.32
162 0.3
163 0.25
164 0.21
165 0.18
166 0.15
167 0.13
168 0.08
169 0.08
170 0.07
171 0.07
172 0.06
173 0.05
174 0.06
175 0.07
176 0.07