Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EYJ2

Protein Details
Accession A7EYJ2    Localization Confidence High Confidence Score 19.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-102LGDLSLMKKKKKKSKKVDEGEEGGBasic
111-134LDLSTMKKKKKSSKKPKDSEDDFTHydrophilic
NLS Segment(s)
PositionSequence
86-94KKKKKKSKK
117-127KKKKKSSKKPK
Subcellular Location(s) nucl 21, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045196  IF2/IF5  
IPR002735  Transl_init_fac_IF2/IF5_dom  
IPR016189  Transl_init_fac_IF2/IF5_N  
IPR016190  Transl_init_fac_IF2/IF5_Zn-bd  
Gene Ontology GO:0005850  C:eukaryotic translation initiation factor 2 complex  
GO:0003729  F:mRNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0031369  F:translation initiation factor binding  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
GO:0001731  P:formation of translation preinitiation complex  
KEGG ssl:SS1G_10408  -  
Pfam View protein in Pfam  
PF01873  eIF-5_eIF-2B  
Amino Acid Sequences MADEVDVKPRKSVAFSDGTTIVDENGEVTMKEDGHDDTKETAQSHSPSTPPLSKALGAFTDPFQGNGDEATANNEDDGLGDLSLMKKKKKKSKKVDEGEEGGDEAAADGGLDLSTMKKKKKSSKKPKDSEDDFTARLAAANLNDDGEKAAEETPVDEGDMMKGTGIWAHDETKLIPYEQLLSRFFTLLAQKNPDHASSGSKSYKIPPPQCLREGNKKTIFANIAEICKRMKRTDEHVTQYLFAELGTNGSVDGSRRLVIKGRFQQKQIENVLRKYIMEYVTCKTCRSPDTELNKGENRLFFITCNSCGSRRSVTAIKTGFSAQVGKRRRQQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.35
4 0.34
5 0.32
6 0.3
7 0.27
8 0.21
9 0.14
10 0.13
11 0.09
12 0.08
13 0.08
14 0.07
15 0.08
16 0.1
17 0.1
18 0.11
19 0.12
20 0.13
21 0.17
22 0.17
23 0.18
24 0.19
25 0.21
26 0.24
27 0.23
28 0.23
29 0.25
30 0.26
31 0.28
32 0.28
33 0.26
34 0.26
35 0.31
36 0.34
37 0.3
38 0.31
39 0.3
40 0.28
41 0.28
42 0.28
43 0.24
44 0.2
45 0.2
46 0.18
47 0.21
48 0.2
49 0.2
50 0.18
51 0.17
52 0.16
53 0.14
54 0.15
55 0.09
56 0.09
57 0.12
58 0.12
59 0.11
60 0.11
61 0.11
62 0.09
63 0.09
64 0.11
65 0.08
66 0.06
67 0.06
68 0.07
69 0.09
70 0.15
71 0.18
72 0.22
73 0.27
74 0.37
75 0.48
76 0.58
77 0.67
78 0.74
79 0.82
80 0.87
81 0.91
82 0.91
83 0.86
84 0.79
85 0.7
86 0.58
87 0.47
88 0.36
89 0.25
90 0.16
91 0.09
92 0.05
93 0.03
94 0.03
95 0.02
96 0.02
97 0.02
98 0.03
99 0.03
100 0.04
101 0.1
102 0.14
103 0.18
104 0.24
105 0.32
106 0.42
107 0.54
108 0.64
109 0.7
110 0.78
111 0.85
112 0.89
113 0.9
114 0.89
115 0.83
116 0.78
117 0.73
118 0.65
119 0.54
120 0.45
121 0.37
122 0.27
123 0.22
124 0.16
125 0.1
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.07
133 0.06
134 0.06
135 0.05
136 0.06
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.05
146 0.06
147 0.05
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.06
154 0.06
155 0.08
156 0.09
157 0.1
158 0.1
159 0.11
160 0.12
161 0.11
162 0.1
163 0.08
164 0.12
165 0.13
166 0.16
167 0.14
168 0.15
169 0.16
170 0.16
171 0.16
172 0.14
173 0.18
174 0.19
175 0.2
176 0.23
177 0.23
178 0.26
179 0.27
180 0.25
181 0.22
182 0.18
183 0.2
184 0.18
185 0.25
186 0.23
187 0.23
188 0.24
189 0.26
190 0.32
191 0.37
192 0.39
193 0.41
194 0.47
195 0.51
196 0.54
197 0.57
198 0.56
199 0.59
200 0.61
201 0.61
202 0.57
203 0.55
204 0.51
205 0.48
206 0.44
207 0.33
208 0.34
209 0.27
210 0.27
211 0.26
212 0.26
213 0.23
214 0.25
215 0.27
216 0.23
217 0.26
218 0.27
219 0.34
220 0.43
221 0.49
222 0.52
223 0.53
224 0.52
225 0.47
226 0.43
227 0.35
228 0.25
229 0.17
230 0.12
231 0.08
232 0.08
233 0.07
234 0.06
235 0.06
236 0.06
237 0.07
238 0.06
239 0.09
240 0.09
241 0.1
242 0.11
243 0.13
244 0.19
245 0.23
246 0.32
247 0.38
248 0.46
249 0.5
250 0.51
251 0.59
252 0.57
253 0.62
254 0.6
255 0.61
256 0.57
257 0.55
258 0.58
259 0.49
260 0.45
261 0.39
262 0.35
263 0.28
264 0.25
265 0.26
266 0.25
267 0.32
268 0.33
269 0.32
270 0.3
271 0.33
272 0.33
273 0.37
274 0.4
275 0.42
276 0.49
277 0.56
278 0.58
279 0.59
280 0.6
281 0.57
282 0.53
283 0.45
284 0.42
285 0.37
286 0.33
287 0.28
288 0.3
289 0.31
290 0.29
291 0.32
292 0.31
293 0.3
294 0.31
295 0.35
296 0.34
297 0.32
298 0.36
299 0.37
300 0.37
301 0.43
302 0.43
303 0.39
304 0.35
305 0.35
306 0.3
307 0.26
308 0.3
309 0.26
310 0.33
311 0.4
312 0.46