Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5G5C2

Protein Details
Accession M5G5C2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
4-30SYPHPRPRPSHSHSNSRPKPARQRSTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MSMSYPHPRPRPSHSHSNSRPKPARQRSTSAPGARGPTSPASPSPSPFPTRRGWEEQGPEDERAWEEAEAYAECPGWCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.74
4 0.8
5 0.78
6 0.78
7 0.78
8 0.75
9 0.8
10 0.8
11 0.8
12 0.74
13 0.74
14 0.69
15 0.7
16 0.69
17 0.6
18 0.51
19 0.44
20 0.42
21 0.37
22 0.31
23 0.26
24 0.2
25 0.18
26 0.17
27 0.15
28 0.18
29 0.18
30 0.18
31 0.2
32 0.22
33 0.25
34 0.26
35 0.29
36 0.29
37 0.35
38 0.39
39 0.42
40 0.42
41 0.44
42 0.48
43 0.47
44 0.48
45 0.45
46 0.41
47 0.35
48 0.32
49 0.27
50 0.23
51 0.21
52 0.15
53 0.12
54 0.12
55 0.13
56 0.12
57 0.12
58 0.11
59 0.11