Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5GBF8

Protein Details
Accession M5GBF8   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-56LSGYNVPHSKHKTKRKWKPNVHTKRLFSEHydrophilic
NLS Segment(s)
PositionSequence
37-46KHKTKRKWKP
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MFRTLARLYNIQALRGPTTHLFEGRTTLSGYNVPHSKHKTKRKWKPNVHTKRLFSESLGGTVKVRLTASTLRTIDKYGGLDSYMLRNKNLHEFERMGGSAMALRIRIREAEKEKVDKALAEEMHKMGLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.28
4 0.22
5 0.26
6 0.26
7 0.25
8 0.24
9 0.21
10 0.24
11 0.22
12 0.21
13 0.18
14 0.16
15 0.16
16 0.17
17 0.17
18 0.2
19 0.23
20 0.23
21 0.29
22 0.36
23 0.44
24 0.5
25 0.6
26 0.65
27 0.73
28 0.82
29 0.85
30 0.89
31 0.91
32 0.92
33 0.93
34 0.93
35 0.91
36 0.89
37 0.81
38 0.75
39 0.69
40 0.58
41 0.47
42 0.41
43 0.32
44 0.27
45 0.25
46 0.19
47 0.15
48 0.15
49 0.15
50 0.1
51 0.1
52 0.07
53 0.09
54 0.12
55 0.13
56 0.18
57 0.19
58 0.19
59 0.19
60 0.2
61 0.19
62 0.17
63 0.16
64 0.11
65 0.1
66 0.09
67 0.09
68 0.09
69 0.15
70 0.17
71 0.17
72 0.18
73 0.19
74 0.2
75 0.28
76 0.31
77 0.27
78 0.27
79 0.28
80 0.28
81 0.31
82 0.29
83 0.22
84 0.18
85 0.16
86 0.13
87 0.12
88 0.12
89 0.1
90 0.1
91 0.1
92 0.11
93 0.14
94 0.16
95 0.24
96 0.29
97 0.37
98 0.43
99 0.47
100 0.47
101 0.48
102 0.46
103 0.38
104 0.36
105 0.34
106 0.3
107 0.28
108 0.3
109 0.27