Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EHN4

Protein Details
Accession A7EHN4    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MENGKQTKWHRNSRLIFRYYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 12.833, cyto_nucl 9.666, mito 9
Family & Domain DBs
KEGG ssl:SS1G_04826  -  
Amino Acid Sequences MENGKQTKWHRNSRLIFRYYVKLSEPLKGVRPPNRQIDFVVSRYSWSARKDSLWNLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.72
3 0.67
4 0.6
5 0.58
6 0.5
7 0.44
8 0.34
9 0.32
10 0.3
11 0.3
12 0.29
13 0.25
14 0.27
15 0.29
16 0.33
17 0.35
18 0.41
19 0.42
20 0.5
21 0.5
22 0.48
23 0.45
24 0.48
25 0.43
26 0.38
27 0.36
28 0.27
29 0.25
30 0.26
31 0.27
32 0.24
33 0.23
34 0.26
35 0.25
36 0.3
37 0.34