Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5GBP8

Protein Details
Accession M5GBP8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25VYPTSAPNDKRQPRERQPDYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, cyto_pero 7.5, mito 6, pero 5.5, mito_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MGLTDVYPTSAPNDKRQPRERQPDYPIAGFGGKVATSFRVRRVYQLTTPYISRLLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.55
3 0.63
4 0.69
5 0.72
6 0.8
7 0.78
8 0.75
9 0.74
10 0.72
11 0.67
12 0.57
13 0.47
14 0.37
15 0.3
16 0.22
17 0.16
18 0.09
19 0.06
20 0.06
21 0.06
22 0.08
23 0.12
24 0.14
25 0.2
26 0.27
27 0.27
28 0.33
29 0.38
30 0.41
31 0.42
32 0.47
33 0.46
34 0.42
35 0.42
36 0.39