Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FW50

Protein Details
Accession M5FW50   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
10-35QGGSTESRWKKGKKRWRNFCLYHSSTHydrophilic
NLS Segment(s)
PositionSequence
18-24WKKGKKR
Subcellular Location(s) plas 20, E.R. 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037737  Srf1  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDPNGEKSAQGGSTESRWKKGKKRWRNFCLYHSSTPLLFRLLNLIFTTIALAVAIRMQLEERHAGVEGVLGSSTAVTILEYYGRPLGLWRTSAKLAYTLVEVIFVCLWSSALSLAIDNYLTTPLRCAPRNLTSWWSDQPPTPNPLSPDDSDIGQDVCRLQAALIGLVLVGLCSYCSNLIISLFRIFERVKVRTVDYRWSALGDGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.36
4 0.43
5 0.5
6 0.58
7 0.66
8 0.72
9 0.73
10 0.82
11 0.87
12 0.89
13 0.91
14 0.87
15 0.84
16 0.83
17 0.78
18 0.71
19 0.65
20 0.57
21 0.48
22 0.44
23 0.37
24 0.3
25 0.23
26 0.18
27 0.2
28 0.18
29 0.18
30 0.16
31 0.16
32 0.14
33 0.13
34 0.14
35 0.08
36 0.08
37 0.06
38 0.05
39 0.04
40 0.05
41 0.05
42 0.04
43 0.04
44 0.05
45 0.06
46 0.08
47 0.1
48 0.09
49 0.1
50 0.1
51 0.1
52 0.09
53 0.1
54 0.08
55 0.06
56 0.06
57 0.05
58 0.04
59 0.04
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.05
67 0.05
68 0.06
69 0.07
70 0.06
71 0.06
72 0.07
73 0.1
74 0.1
75 0.12
76 0.12
77 0.14
78 0.15
79 0.16
80 0.15
81 0.14
82 0.13
83 0.11
84 0.11
85 0.09
86 0.08
87 0.08
88 0.07
89 0.07
90 0.06
91 0.05
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.06
108 0.06
109 0.07
110 0.1
111 0.15
112 0.16
113 0.18
114 0.22
115 0.27
116 0.3
117 0.31
118 0.31
119 0.3
120 0.32
121 0.32
122 0.3
123 0.26
124 0.26
125 0.29
126 0.29
127 0.3
128 0.29
129 0.29
130 0.28
131 0.31
132 0.33
133 0.28
134 0.29
135 0.25
136 0.24
137 0.22
138 0.2
139 0.17
140 0.12
141 0.12
142 0.09
143 0.08
144 0.08
145 0.07
146 0.06
147 0.08
148 0.08
149 0.08
150 0.07
151 0.07
152 0.06
153 0.06
154 0.06
155 0.04
156 0.03
157 0.02
158 0.03
159 0.03
160 0.04
161 0.05
162 0.06
163 0.07
164 0.08
165 0.1
166 0.11
167 0.13
168 0.15
169 0.15
170 0.15
171 0.18
172 0.18
173 0.22
174 0.28
175 0.28
176 0.3
177 0.32
178 0.37
179 0.41
180 0.44
181 0.48
182 0.44
183 0.45
184 0.42
185 0.4
186 0.36