Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G3Y0

Protein Details
Accession M5G3Y0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-45WEPSWRCSECKKKAFSRRTRTSSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036045  Sec1-like_sf  
Amino Acid Sequences MLSHSWTYQSLVHDVLEMNRLWEPSWRCSECKKKAFSRRTRTSSDLLSDDKVDLGELEKELKKEVAISHAAMTNLAAAAPVAQPSNTTNELFRGFSSLSNRLTERLKEGGLREKRAQVLAELGSQQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.17
4 0.14
5 0.14
6 0.14
7 0.14
8 0.14
9 0.2
10 0.22
11 0.25
12 0.34
13 0.35
14 0.36
15 0.45
16 0.56
17 0.59
18 0.63
19 0.65
20 0.66
21 0.74
22 0.81
23 0.83
24 0.83
25 0.83
26 0.81
27 0.79
28 0.73
29 0.66
30 0.58
31 0.5
32 0.42
33 0.34
34 0.29
35 0.24
36 0.19
37 0.16
38 0.13
39 0.1
40 0.07
41 0.06
42 0.06
43 0.06
44 0.09
45 0.1
46 0.1
47 0.11
48 0.11
49 0.1
50 0.1
51 0.11
52 0.11
53 0.11
54 0.11
55 0.12
56 0.13
57 0.13
58 0.11
59 0.11
60 0.08
61 0.06
62 0.05
63 0.04
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.06
71 0.07
72 0.12
73 0.13
74 0.14
75 0.14
76 0.16
77 0.18
78 0.18
79 0.17
80 0.16
81 0.14
82 0.17
83 0.21
84 0.23
85 0.23
86 0.26
87 0.26
88 0.26
89 0.29
90 0.28
91 0.27
92 0.26
93 0.25
94 0.26
95 0.29
96 0.36
97 0.39
98 0.44
99 0.44
100 0.46
101 0.48
102 0.47
103 0.44
104 0.36
105 0.34
106 0.29
107 0.27