Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F5R8

Protein Details
Accession A7F5R8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
192-211LTHSLKKAPGGKKKRKHAVEBasic
NLS Segment(s)
PositionSequence
196-208LKKAPGGKKKRKH
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
GO:0071171  P:site-specific DNA replication termination at RTS1 barrier  
KEGG ssl:SS1G_12946  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSIPTRRELVKEAARNPNTSELKATLHEAQTHAWTYCPLSNQPLAAPIVSDCAGTLYNKDAIITQLLPKDDDVPASVIKEKEEVLQGRVKSLRDIVEVKFSTVMEDKEEKKICPITSKELGASARAVYLVPCGHAFSEVAIRELKGDACVECNEGYTAENVIPILPIAKEDIARLASRAAKLKEDGLTHSLKKAPGGKKKRKHAVETESAVPMESGKDDSIDSKQPRSQGTGVADKPQSRIQENGNGASTPKLNNGASTVSSGIKNASAANLTAKVLEEQEERNKRRKLGMNDNLKSLFSNTGYNAQKQKGGDFMTRGFSMNKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.45
4 0.5
5 0.58
6 0.6
7 0.6
8 0.58
9 0.59
10 0.53
11 0.47
12 0.43
13 0.34
14 0.34
15 0.33
16 0.34
17 0.3
18 0.29
19 0.3
20 0.28
21 0.27
22 0.28
23 0.29
24 0.25
25 0.2
26 0.19
27 0.2
28 0.21
29 0.23
30 0.22
31 0.24
32 0.26
33 0.26
34 0.25
35 0.25
36 0.23
37 0.2
38 0.18
39 0.13
40 0.14
41 0.14
42 0.13
43 0.09
44 0.09
45 0.1
46 0.1
47 0.11
48 0.11
49 0.13
50 0.13
51 0.14
52 0.13
53 0.13
54 0.16
55 0.16
56 0.16
57 0.17
58 0.18
59 0.19
60 0.18
61 0.2
62 0.17
63 0.17
64 0.15
65 0.13
66 0.14
67 0.15
68 0.18
69 0.15
70 0.16
71 0.16
72 0.15
73 0.15
74 0.2
75 0.2
76 0.2
77 0.25
78 0.24
79 0.27
80 0.3
81 0.28
82 0.24
83 0.25
84 0.24
85 0.22
86 0.25
87 0.22
88 0.28
89 0.27
90 0.26
91 0.25
92 0.23
93 0.21
94 0.2
95 0.2
96 0.15
97 0.2
98 0.21
99 0.27
100 0.29
101 0.27
102 0.29
103 0.33
104 0.3
105 0.32
106 0.33
107 0.32
108 0.34
109 0.35
110 0.31
111 0.3
112 0.29
113 0.23
114 0.21
115 0.14
116 0.11
117 0.1
118 0.1
119 0.06
120 0.08
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.08
127 0.08
128 0.06
129 0.11
130 0.1
131 0.11
132 0.11
133 0.11
134 0.11
135 0.11
136 0.11
137 0.07
138 0.08
139 0.07
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.08
147 0.08
148 0.07
149 0.07
150 0.06
151 0.06
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.03
158 0.04
159 0.05
160 0.05
161 0.06
162 0.06
163 0.08
164 0.08
165 0.08
166 0.09
167 0.1
168 0.12
169 0.13
170 0.18
171 0.17
172 0.18
173 0.18
174 0.2
175 0.21
176 0.2
177 0.2
178 0.19
179 0.21
180 0.2
181 0.21
182 0.22
183 0.19
184 0.21
185 0.27
186 0.32
187 0.39
188 0.5
189 0.58
190 0.64
191 0.74
192 0.81
193 0.79
194 0.78
195 0.76
196 0.73
197 0.71
198 0.66
199 0.58
200 0.49
201 0.43
202 0.36
203 0.27
204 0.19
205 0.12
206 0.09
207 0.07
208 0.06
209 0.07
210 0.07
211 0.09
212 0.12
213 0.2
214 0.21
215 0.24
216 0.26
217 0.29
218 0.31
219 0.34
220 0.32
221 0.29
222 0.32
223 0.36
224 0.34
225 0.37
226 0.38
227 0.34
228 0.36
229 0.35
230 0.34
231 0.28
232 0.3
233 0.28
234 0.33
235 0.34
236 0.34
237 0.31
238 0.28
239 0.26
240 0.25
241 0.23
242 0.16
243 0.16
244 0.18
245 0.17
246 0.17
247 0.19
248 0.19
249 0.18
250 0.18
251 0.18
252 0.15
253 0.15
254 0.15
255 0.14
256 0.12
257 0.12
258 0.11
259 0.11
260 0.1
261 0.1
262 0.13
263 0.14
264 0.13
265 0.13
266 0.14
267 0.13
268 0.13
269 0.15
270 0.15
271 0.18
272 0.28
273 0.38
274 0.42
275 0.5
276 0.54
277 0.55
278 0.61
279 0.66
280 0.65
281 0.67
282 0.72
283 0.74
284 0.71
285 0.73
286 0.65
287 0.56
288 0.48
289 0.38
290 0.33
291 0.24
292 0.25
293 0.21
294 0.29
295 0.32
296 0.37
297 0.41
298 0.39
299 0.42
300 0.4
301 0.4
302 0.37
303 0.38
304 0.37
305 0.35
306 0.36
307 0.36
308 0.36
309 0.36
310 0.33