Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5GBP9

Protein Details
Accession M5GBP9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
78-108REMERRRGKGAPKKLKTKSEDGQKNKKKKKKBasic
NLS Segment(s)
PositionSequence
79-108EMERRRGKGAPKKLKTKSEDGQKNKKKKKK
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MASLATKMRQLARLRSTIFDTSYNPSSARTGAKYIRRRLLGPAMVRYYPQKIDMKLVKALAWDMDLLDPAEEERREDREMERRRGKGAPKKLKTKSEDGQKNKKKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.47
4 0.42
5 0.4
6 0.33
7 0.3
8 0.29
9 0.3
10 0.29
11 0.24
12 0.23
13 0.22
14 0.22
15 0.22
16 0.19
17 0.21
18 0.26
19 0.35
20 0.42
21 0.47
22 0.51
23 0.5
24 0.49
25 0.49
26 0.5
27 0.46
28 0.4
29 0.38
30 0.35
31 0.32
32 0.32
33 0.29
34 0.25
35 0.2
36 0.22
37 0.21
38 0.19
39 0.24
40 0.27
41 0.27
42 0.27
43 0.26
44 0.22
45 0.19
46 0.19
47 0.13
48 0.1
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.08
58 0.08
59 0.1
60 0.11
61 0.15
62 0.16
63 0.18
64 0.22
65 0.29
66 0.37
67 0.45
68 0.51
69 0.49
70 0.52
71 0.57
72 0.62
73 0.62
74 0.65
75 0.66
76 0.67
77 0.76
78 0.8
79 0.83
80 0.8
81 0.78
82 0.75
83 0.75
84 0.77
85 0.76
86 0.8
87 0.8
88 0.86