Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5GGC2

Protein Details
Accession M5GGC2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-48THGHDESKPKSKPKPKSKPTHTPKPPKNSNPLPBasic
NLS Segment(s)
PositionSequence
23-42KPKSKPKPKSKPTHTPKPPK
Subcellular Location(s) nucl 16, cyto 7, extr 1, pero 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MPVVSQHEIAHDSKYTHGHDESKPKSKPKPKSKPTHTPKPPKNSNPLPSGAVDYTQGYSDRFVTLSLPARTLTIHHYMFPFFSPTLALDDILHLQRVSSALGQSWVVRSKWGLLRVGFSTVDPRGSRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.27
4 0.29
5 0.31
6 0.35
7 0.44
8 0.48
9 0.53
10 0.56
11 0.58
12 0.66
13 0.7
14 0.75
15 0.76
16 0.8
17 0.81
18 0.87
19 0.89
20 0.9
21 0.9
22 0.9
23 0.89
24 0.89
25 0.87
26 0.86
27 0.87
28 0.82
29 0.82
30 0.79
31 0.75
32 0.67
33 0.61
34 0.52
35 0.43
36 0.4
37 0.3
38 0.22
39 0.17
40 0.14
41 0.12
42 0.11
43 0.1
44 0.08
45 0.08
46 0.09
47 0.08
48 0.08
49 0.07
50 0.07
51 0.09
52 0.14
53 0.14
54 0.14
55 0.14
56 0.14
57 0.14
58 0.14
59 0.16
60 0.15
61 0.15
62 0.16
63 0.16
64 0.17
65 0.17
66 0.17
67 0.16
68 0.1
69 0.1
70 0.09
71 0.09
72 0.12
73 0.12
74 0.12
75 0.09
76 0.1
77 0.13
78 0.12
79 0.12
80 0.09
81 0.09
82 0.09
83 0.1
84 0.1
85 0.09
86 0.09
87 0.09
88 0.1
89 0.11
90 0.11
91 0.14
92 0.17
93 0.16
94 0.16
95 0.17
96 0.22
97 0.27
98 0.3
99 0.31
100 0.28
101 0.32
102 0.32
103 0.35
104 0.29
105 0.24
106 0.25
107 0.22
108 0.27
109 0.24