Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EWD6

Protein Details
Accession A7EWD6    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-68VWNHAKRRTGPRWRLHPKPNRRAEVKDPBasic
NLS Segment(s)
PositionSequence
45-65AKRRTGPRWRLHPKPNRRAEV
Subcellular Location(s) nucl 18, mito 5, cyto 3
Family & Domain DBs
KEGG ssl:SS1G_09645  -  
Amino Acid Sequences MDAHSVLPLSPYLSRERGLSPLIENNVLSTASTLQDIHKVVWNHAKRRTGPRWRLHPKPNRRAEVKDPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.23
5 0.22
6 0.21
7 0.19
8 0.21
9 0.21
10 0.2
11 0.18
12 0.16
13 0.15
14 0.14
15 0.12
16 0.08
17 0.07
18 0.06
19 0.07
20 0.07
21 0.07
22 0.1
23 0.1
24 0.11
25 0.14
26 0.15
27 0.16
28 0.25
29 0.31
30 0.33
31 0.39
32 0.45
33 0.45
34 0.54
35 0.63
36 0.64
37 0.68
38 0.72
39 0.77
40 0.79
41 0.84
42 0.85
43 0.85
44 0.85
45 0.86
46 0.87
47 0.85
48 0.82
49 0.81