Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FTZ8

Protein Details
Accession M5FTZ8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-78DTPPPRYNDRFRRPSRRNLRQALHydrophilic
191-210PGLGRHRIFGRPRRERQTEPBasic
NLS Segment(s)
PositionSequence
178-183GKKKRR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSLPSNSVSPSPPTASFPPYQTRPSLFSPIIIIPVSVTPSHTADQAAAFNEFVPLDTPPPRYNDRFRRPSRRNLRQALERLETTYGPWESLLNLPLTASASTSASSSPESSSLLSATASSSSTPMFAPPRPLPSYSDAYLLPPSYPFPSPDPSASLSSVVPGWDKHPVPDELPPPFGGKKKRRSLLDILMPGLGRHRIFGRPRRERQTEPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.35
4 0.35
5 0.39
6 0.4
7 0.42
8 0.41
9 0.41
10 0.4
11 0.42
12 0.45
13 0.37
14 0.33
15 0.33
16 0.3
17 0.29
18 0.24
19 0.19
20 0.13
21 0.14
22 0.15
23 0.11
24 0.12
25 0.12
26 0.14
27 0.15
28 0.15
29 0.15
30 0.13
31 0.15
32 0.15
33 0.14
34 0.12
35 0.11
36 0.1
37 0.11
38 0.1
39 0.09
40 0.08
41 0.08
42 0.1
43 0.13
44 0.17
45 0.18
46 0.22
47 0.27
48 0.32
49 0.41
50 0.49
51 0.56
52 0.62
53 0.69
54 0.76
55 0.76
56 0.82
57 0.83
58 0.83
59 0.82
60 0.79
61 0.77
62 0.74
63 0.74
64 0.69
65 0.61
66 0.51
67 0.43
68 0.37
69 0.3
70 0.23
71 0.21
72 0.15
73 0.12
74 0.12
75 0.11
76 0.1
77 0.11
78 0.12
79 0.08
80 0.08
81 0.07
82 0.07
83 0.08
84 0.07
85 0.06
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.08
98 0.08
99 0.07
100 0.07
101 0.06
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.06
110 0.06
111 0.08
112 0.11
113 0.11
114 0.17
115 0.18
116 0.24
117 0.26
118 0.27
119 0.28
120 0.3
121 0.33
122 0.28
123 0.28
124 0.22
125 0.22
126 0.22
127 0.2
128 0.15
129 0.11
130 0.12
131 0.13
132 0.13
133 0.14
134 0.16
135 0.2
136 0.22
137 0.22
138 0.24
139 0.24
140 0.25
141 0.24
142 0.22
143 0.18
144 0.16
145 0.16
146 0.13
147 0.11
148 0.1
149 0.11
150 0.17
151 0.17
152 0.18
153 0.22
154 0.23
155 0.24
156 0.3
157 0.33
158 0.29
159 0.31
160 0.3
161 0.29
162 0.31
163 0.35
164 0.39
165 0.44
166 0.51
167 0.59
168 0.66
169 0.68
170 0.71
171 0.73
172 0.72
173 0.72
174 0.65
175 0.56
176 0.5
177 0.45
178 0.38
179 0.33
180 0.28
181 0.19
182 0.18
183 0.2
184 0.26
185 0.35
186 0.44
187 0.52
188 0.58
189 0.68
190 0.75
191 0.8