Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5GH15

Protein Details
Accession M5GH15   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-100GVPTPPSPSKKRRNRVTLSCKECHRRKQQCDRGNPCSRCHydrophilic
NLS Segment(s)
PositionSequence
68-74SPSKKRR
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSAIVASLTTLPQQETPVTSTGASPIPPPGPPPPPPPPSVNGNGPPSHPGPPPAPPAPRATGVPTPPSPSKKRRNRVTLSCKECHRRKQQCDRGNPCSRCVKRGMADKCVME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.17
4 0.17
5 0.17
6 0.16
7 0.15
8 0.16
9 0.15
10 0.14
11 0.12
12 0.14
13 0.14
14 0.14
15 0.17
16 0.2
17 0.24
18 0.27
19 0.34
20 0.38
21 0.41
22 0.43
23 0.43
24 0.41
25 0.41
26 0.42
27 0.39
28 0.36
29 0.36
30 0.34
31 0.32
32 0.31
33 0.28
34 0.27
35 0.22
36 0.2
37 0.18
38 0.21
39 0.25
40 0.26
41 0.26
42 0.24
43 0.27
44 0.27
45 0.26
46 0.24
47 0.22
48 0.22
49 0.22
50 0.25
51 0.22
52 0.25
53 0.28
54 0.33
55 0.36
56 0.42
57 0.51
58 0.57
59 0.67
60 0.72
61 0.77
62 0.8
63 0.84
64 0.86
65 0.85
66 0.82
67 0.77
68 0.75
69 0.75
70 0.74
71 0.73
72 0.74
73 0.74
74 0.77
75 0.84
76 0.87
77 0.86
78 0.89
79 0.88
80 0.87
81 0.87
82 0.79
83 0.73
84 0.73
85 0.67
86 0.6
87 0.56
88 0.54
89 0.51
90 0.59
91 0.59
92 0.56