Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5GGT9

Protein Details
Accession M5GGT9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-26FSLITGKPSHSKRRRLSIAPGGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002259  Eqnu_transpt  
Gene Ontology GO:0016020  C:membrane  
GO:0005337  F:nucleoside transmembrane transporter activity  
Pfam View protein in Pfam  
PF01733  Nucleoside_tran  
Amino Acid Sequences MSYLFSLITGKPSHSKRRRLSIAPGGGYAPIPEDPTEPRTSAGLEQEITGVPPLGRGVRWVHFSLGAAVLLPWNAMITAMPYFLSRLEGSALQSSFASWLATSFTAANFIVLGYATYTSDVSESALRIRLSMGAIIIMFMLLTLSTLVPTSAGAYFAFTIIIGMLLASAGSYTSNSLVALASIFGPMAMQSVMSGQAAIGVLVSLVQLISAWLSIGRSATSSGGESRSAFGFFGVEVVFLFGCMFAHSWLTSLRVYGRAIEPWTTPSKGNSTPALQVEDGVYGESEETSVTLGQKRDASTLWKVARKNLTYNFAVAYVFVVTLAVYPSITTSIKSVHDPSTSVLFNPLIFTALHFLMFNIGDWIGRHLCAYPIFLAWRPRNLLFLSLARTIFIPLFLMCNVEGLSGRGPVIHSDFIYMLILLLFGITNGQVSSNIMMAAPSTDHNKTLLREEIDTAATVASFCLMGGLLTGSILSFGVWAMVCGCDPFRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.62
3 0.66
4 0.75
5 0.81
6 0.79
7 0.8
8 0.79
9 0.79
10 0.7
11 0.63
12 0.53
13 0.45
14 0.39
15 0.29
16 0.21
17 0.13
18 0.13
19 0.13
20 0.14
21 0.18
22 0.23
23 0.26
24 0.24
25 0.25
26 0.24
27 0.25
28 0.26
29 0.27
30 0.24
31 0.21
32 0.21
33 0.21
34 0.2
35 0.18
36 0.16
37 0.12
38 0.09
39 0.09
40 0.11
41 0.11
42 0.11
43 0.14
44 0.18
45 0.21
46 0.26
47 0.26
48 0.26
49 0.26
50 0.26
51 0.25
52 0.22
53 0.17
54 0.13
55 0.12
56 0.1
57 0.09
58 0.08
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.08
70 0.09
71 0.12
72 0.1
73 0.1
74 0.12
75 0.13
76 0.15
77 0.19
78 0.19
79 0.16
80 0.16
81 0.16
82 0.14
83 0.13
84 0.12
85 0.07
86 0.07
87 0.09
88 0.09
89 0.1
90 0.09
91 0.09
92 0.11
93 0.11
94 0.11
95 0.08
96 0.08
97 0.07
98 0.06
99 0.06
100 0.05
101 0.05
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.08
110 0.09
111 0.1
112 0.14
113 0.14
114 0.14
115 0.14
116 0.14
117 0.14
118 0.13
119 0.11
120 0.08
121 0.08
122 0.08
123 0.07
124 0.05
125 0.04
126 0.03
127 0.03
128 0.02
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.06
138 0.05
139 0.06
140 0.06
141 0.07
142 0.07
143 0.07
144 0.07
145 0.06
146 0.05
147 0.04
148 0.04
149 0.03
150 0.03
151 0.03
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.03
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.03
174 0.04
175 0.03
176 0.03
177 0.03
178 0.04
179 0.05
180 0.05
181 0.05
182 0.04
183 0.05
184 0.05
185 0.05
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.02
197 0.02
198 0.02
199 0.03
200 0.03
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.06
207 0.06
208 0.07
209 0.08
210 0.09
211 0.1
212 0.09
213 0.1
214 0.1
215 0.1
216 0.09
217 0.08
218 0.07
219 0.06
220 0.06
221 0.05
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.05
234 0.05
235 0.05
236 0.06
237 0.08
238 0.07
239 0.08
240 0.08
241 0.1
242 0.1
243 0.11
244 0.12
245 0.12
246 0.13
247 0.13
248 0.13
249 0.14
250 0.17
251 0.17
252 0.16
253 0.16
254 0.2
255 0.2
256 0.22
257 0.21
258 0.2
259 0.22
260 0.22
261 0.23
262 0.19
263 0.17
264 0.15
265 0.13
266 0.11
267 0.08
268 0.07
269 0.05
270 0.05
271 0.04
272 0.04
273 0.03
274 0.03
275 0.04
276 0.04
277 0.06
278 0.09
279 0.1
280 0.12
281 0.14
282 0.15
283 0.16
284 0.16
285 0.19
286 0.19
287 0.26
288 0.29
289 0.31
290 0.31
291 0.36
292 0.43
293 0.4
294 0.44
295 0.41
296 0.41
297 0.37
298 0.38
299 0.32
300 0.25
301 0.23
302 0.17
303 0.12
304 0.08
305 0.07
306 0.05
307 0.05
308 0.04
309 0.04
310 0.05
311 0.04
312 0.04
313 0.04
314 0.04
315 0.07
316 0.07
317 0.07
318 0.08
319 0.11
320 0.12
321 0.15
322 0.18
323 0.18
324 0.19
325 0.2
326 0.2
327 0.22
328 0.21
329 0.19
330 0.18
331 0.15
332 0.14
333 0.14
334 0.13
335 0.09
336 0.09
337 0.09
338 0.1
339 0.1
340 0.1
341 0.09
342 0.09
343 0.1
344 0.1
345 0.1
346 0.08
347 0.08
348 0.08
349 0.08
350 0.12
351 0.11
352 0.11
353 0.11
354 0.1
355 0.13
356 0.13
357 0.15
358 0.12
359 0.13
360 0.15
361 0.18
362 0.26
363 0.26
364 0.3
365 0.33
366 0.32
367 0.34
368 0.33
369 0.32
370 0.26
371 0.27
372 0.26
373 0.25
374 0.25
375 0.22
376 0.21
377 0.2
378 0.17
379 0.14
380 0.11
381 0.08
382 0.1
383 0.09
384 0.11
385 0.09
386 0.1
387 0.1
388 0.09
389 0.1
390 0.09
391 0.11
392 0.1
393 0.1
394 0.1
395 0.1
396 0.12
397 0.15
398 0.15
399 0.14
400 0.15
401 0.16
402 0.16
403 0.16
404 0.13
405 0.09
406 0.07
407 0.07
408 0.05
409 0.05
410 0.04
411 0.03
412 0.04
413 0.04
414 0.04
415 0.05
416 0.05
417 0.06
418 0.07
419 0.08
420 0.08
421 0.09
422 0.08
423 0.08
424 0.07
425 0.08
426 0.08
427 0.09
428 0.13
429 0.15
430 0.16
431 0.18
432 0.22
433 0.23
434 0.27
435 0.32
436 0.3
437 0.3
438 0.32
439 0.32
440 0.29
441 0.28
442 0.23
443 0.16
444 0.13
445 0.11
446 0.09
447 0.07
448 0.06
449 0.05
450 0.05
451 0.05
452 0.04
453 0.05
454 0.06
455 0.05
456 0.05
457 0.05
458 0.05
459 0.05
460 0.05
461 0.05
462 0.04
463 0.04
464 0.06
465 0.06
466 0.07
467 0.07
468 0.08
469 0.08
470 0.1
471 0.11