FuNGI

M5GBG5

Protein Details

Accession

M5GBG5

Localization Confidence

Medium

Confidence Score

14.7

NoLS Segment(s)

Position	Sequence	Protein Nature
608-638	LVLLYERRKPLPRKSKRKGRGKARSGRSGMG	Basic

NLS Segment(s)

Position	Sequence
28-36	ARPPARLRK
614-634	RRKPLPRKSKRKGRGKARSGR

Subcellular Location(s)

nucl 20, cyto_nucl 15.5, cyto 7

Family & Domain DBs

InterPro	View protein in InterPro IPR013507 DNA_mismatch_S5_2-like IPR036890 HATPase_C_sf IPR032189 Mlh1_C IPR038973 MutL/Mlh/Pms IPR020568 Ribosomal_S5_D2-typ_fold IPR014721 Ribosomal_S5_D2-typ_fold_subgr
Gene Ontology	GO:0032300 C:mismatch repair complex GO:0005524 F:ATP binding GO:0016887 F:ATP hydrolysis activity GO:0140664 F:ATP-dependent DNA damage sensor activity GO:0030983 F:mismatched DNA binding GO:0061982 P:meiosis I cell cycle process GO:0006298 P:mismatch repair
Pfam	View protein in Pfam PF01119 DNA_mis_repair PF16413 Mlh1_C

Amino Acid Sequences

MSRGGPETPGGRALQFSDGGIPHSRHPARPPARLRKAGVSPSLRRQSITAKDGGLKLPQIVDNGSGIRRADLPLLAARFCTSKLSTFSDLSKLQTHDSCAWRASYPDGLLAPAKAGTSADPKPCAGNDGTTIAVEISSTPLRLRALKSPSDEYAHILDVVQRYAIHHPSLSFLCKRTGSNTADVSTPSSGTVKSAIKTIYDPSVAKELLEAQAEARPKDEFEWQAEAWFTSANYHAKKPTFLLFINHRSGESARVKKAVEAVYSGILPKGACSSIGGVLARIHSSKQLGLTFRASLDNDPSKVNVNVHPTKREVHFLDEEAITEKVADSMQAVLAANDQSRTFQYQTVLTGHSPFKSQGKMKRSDLRKERIAAGFDEDMEREDELEDEENEQDLDLERPRAGPSSSPKPFRKPSQPSYKKVRNDLETRTLDSMFPVLQSSSESQRAQPNMEIEKKEKAPAVSEMKKGKHLHLARIIDRIDESVPLARSIIHQSIADQSRGSHLTLEPAPSLEELVKLAVDAEAAITEQALNPGKIIKSILKTIMAQRAMLAEYFSLEITSSGEMSTLPLLLPGYTPNLDRLPLFLMRLAPQVNWTSESECCSTFLQSLVLLYERRKPLPRKSKRKGRGKARSGRSGMGYFPRSGSISYLLEGERDVVQVAELKDWYRVFERC

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.2
3	0.18
4	0.19
5	0.18
6	0.21
7	0.25
8	0.24
9	0.24
10	0.34
11	0.37
12	0.36
13	0.42
14	0.5
15	0.53
16	0.61
17	0.69
18	0.7
19	0.76
20	0.8
21	0.78
22	0.76
23	0.76
24	0.73
25	0.71
26	0.68
27	0.65
28	0.68
29	0.72
30	0.64
31	0.57
32	0.53
33	0.53
34	0.53
35	0.51
36	0.44
37	0.38
38	0.41
39	0.43
40	0.42
41	0.36
42	0.29
43	0.26
44	0.25
45	0.25
46	0.22
47	0.2
48	0.19
49	0.18
50	0.19
51	0.19
52	0.19
53	0.17
54	0.17
55	0.17
56	0.17
57	0.17
58	0.15
59	0.17
60	0.2
61	0.21
62	0.2
63	0.19
64	0.19
65	0.18
66	0.18
67	0.2
68	0.17
69	0.19
70	0.24
71	0.29
72	0.32
73	0.33
74	0.35
75	0.36
76	0.36
77	0.35
78	0.36
79	0.31
80	0.31
81	0.31
82	0.34
83	0.35
84	0.37
85	0.36
86	0.32
87	0.33
88	0.3
89	0.29
90	0.27
91	0.24
92	0.21
93	0.21
94	0.2
95	0.19
96	0.19
97	0.18
98	0.15
99	0.12
100	0.11
101	0.09
102	0.09
103	0.1
104	0.15
105	0.2
106	0.23
107	0.25
108	0.26
109	0.27
110	0.27
111	0.29
112	0.24
113	0.21
114	0.19
115	0.19
116	0.19
117	0.16
118	0.17
119	0.13
120	0.11
121	0.09
122	0.07
123	0.08
124	0.08
125	0.09
126	0.09
127	0.11
128	0.14
129	0.17
130	0.2
131	0.24
132	0.3
133	0.34
134	0.39
135	0.41
136	0.41
137	0.41
138	0.39
139	0.34
140	0.31
141	0.26
142	0.22
143	0.18
144	0.18
145	0.15
146	0.15
147	0.13
148	0.11
149	0.12
150	0.16
151	0.19
152	0.17
153	0.16
154	0.16
155	0.19
156	0.21
157	0.24
158	0.22
159	0.22
160	0.25
161	0.26
162	0.27
163	0.27
164	0.33
165	0.31
166	0.34
167	0.34
168	0.31
169	0.3
170	0.3
171	0.28
172	0.21
173	0.18
174	0.13
175	0.12
176	0.11
177	0.11
178	0.15
179	0.15
180	0.15
181	0.17
182	0.17
183	0.17
184	0.18
185	0.2
186	0.18
187	0.19
188	0.18
189	0.17
190	0.22
191	0.2
192	0.19
193	0.17
194	0.16
195	0.15
196	0.16
197	0.14
198	0.1
199	0.13
200	0.15
201	0.14
202	0.13
203	0.12
204	0.12
205	0.13
206	0.18
207	0.17
208	0.18
209	0.23
210	0.22
211	0.23
212	0.23
213	0.21
214	0.16
215	0.14
216	0.11
217	0.07
218	0.11
219	0.15
220	0.17
221	0.19
222	0.23
223	0.24
224	0.25
225	0.26
226	0.27
227	0.25
228	0.24
229	0.27
230	0.29
231	0.34
232	0.36
233	0.34
234	0.3
235	0.28
236	0.28
237	0.3
238	0.32
239	0.31
240	0.29
241	0.32
242	0.32
243	0.31
244	0.36
245	0.31
246	0.23
247	0.19
248	0.19
249	0.16
250	0.16
251	0.16
252	0.1
253	0.09
254	0.08
255	0.07
256	0.07
257	0.06
258	0.06
259	0.07
260	0.08
261	0.08
262	0.1
263	0.1
264	0.09
265	0.09
266	0.1
267	0.1
268	0.09
269	0.08
270	0.08
271	0.09
272	0.1
273	0.12
274	0.14
275	0.15
276	0.17
277	0.18
278	0.17
279	0.17
280	0.18
281	0.16
282	0.14
283	0.17
284	0.18
285	0.17
286	0.17
287	0.17
288	0.17
289	0.18
290	0.19
291	0.17
292	0.22
293	0.28
294	0.3
295	0.31
296	0.31
297	0.33
298	0.32
299	0.34
300	0.28
301	0.26
302	0.25
303	0.23
304	0.24
305	0.21
306	0.2
307	0.16
308	0.15
309	0.1
310	0.08
311	0.07
312	0.06
313	0.05
314	0.05
315	0.04
316	0.04
317	0.04
318	0.05
319	0.05
320	0.05
321	0.05
322	0.06
323	0.06
324	0.06
325	0.06
326	0.06
327	0.07
328	0.1
329	0.1
330	0.11
331	0.12
332	0.13
333	0.14
334	0.15
335	0.16
336	0.13
337	0.16
338	0.15
339	0.14
340	0.15
341	0.14
342	0.15
343	0.18
344	0.23
345	0.27
346	0.34
347	0.39
348	0.44
349	0.51
350	0.54
351	0.59
352	0.62
353	0.61
354	0.59
355	0.56
356	0.55
357	0.49
358	0.45
359	0.36
360	0.31
361	0.24
362	0.2
363	0.18
364	0.13
365	0.11
366	0.1
367	0.09
368	0.06
369	0.06
370	0.06
371	0.06
372	0.07
373	0.07
374	0.07
375	0.07
376	0.07
377	0.07
378	0.07
379	0.06
380	0.06
381	0.07
382	0.07
383	0.08
384	0.08
385	0.09
386	0.1
387	0.11
388	0.11
389	0.14
390	0.19
391	0.28
392	0.33
393	0.41
394	0.44
395	0.5
396	0.55
397	0.58
398	0.63
399	0.61
400	0.65
401	0.69
402	0.74
403	0.73
404	0.78
405	0.79
406	0.74
407	0.73
408	0.7
409	0.65
410	0.62
411	0.6
412	0.59
413	0.53
414	0.5
415	0.44
416	0.38
417	0.31
418	0.26
419	0.22
420	0.13
421	0.11
422	0.09
423	0.07
424	0.07
425	0.08
426	0.1
427	0.13
428	0.18
429	0.18
430	0.2
431	0.25
432	0.27
433	0.27
434	0.27
435	0.28
436	0.29
437	0.34
438	0.34
439	0.31
440	0.35
441	0.35
442	0.35
443	0.33
444	0.28
445	0.25
446	0.29
447	0.36
448	0.35
449	0.4
450	0.43
451	0.43
452	0.5
453	0.49
454	0.45
455	0.45
456	0.43
457	0.44
458	0.46
459	0.5
460	0.45
461	0.48
462	0.45
463	0.36
464	0.33
465	0.28
466	0.2
467	0.15
468	0.14
469	0.13
470	0.13
471	0.13
472	0.12
473	0.11
474	0.13
475	0.17
476	0.18
477	0.15
478	0.14
479	0.15
480	0.23
481	0.25
482	0.24
483	0.19
484	0.18
485	0.21
486	0.22
487	0.22
488	0.16
489	0.14
490	0.18
491	0.19
492	0.21
493	0.17
494	0.16
495	0.16
496	0.14
497	0.15
498	0.1
499	0.09
500	0.08
501	0.08
502	0.07
503	0.06
504	0.07
505	0.06
506	0.05
507	0.04
508	0.04
509	0.04
510	0.04
511	0.04
512	0.04
513	0.04
514	0.04
515	0.09
516	0.11
517	0.1
518	0.11
519	0.14
520	0.14
521	0.15
522	0.18
523	0.18
524	0.2
525	0.23
526	0.26
527	0.25
528	0.27
529	0.32
530	0.37
531	0.33
532	0.3
533	0.26
534	0.26
535	0.24
536	0.22
537	0.17
538	0.09
539	0.09
540	0.1
541	0.09
542	0.07
543	0.07
544	0.07
545	0.07
546	0.08
547	0.07
548	0.07
549	0.07
550	0.07
551	0.08
552	0.08
553	0.07
554	0.06
555	0.07
556	0.07
557	0.07
558	0.08
559	0.08
560	0.12
561	0.13
562	0.14
563	0.16
564	0.17
565	0.18
566	0.18
567	0.18
568	0.18
569	0.19
570	0.19
571	0.18
572	0.19
573	0.19
574	0.23
575	0.23
576	0.19
577	0.21
578	0.23
579	0.23
580	0.24
581	0.24
582	0.22
583	0.23
584	0.26
585	0.25
586	0.22
587	0.23
588	0.21
589	0.21
590	0.19
591	0.19
592	0.16
593	0.14
594	0.14
595	0.13
596	0.15
597	0.15
598	0.16
599	0.24
600	0.27
601	0.33
602	0.41
603	0.47
604	0.56
605	0.65
606	0.74
607	0.77
608	0.83
609	0.89
610	0.91
611	0.94
612	0.94
613	0.94
614	0.94
615	0.93
616	0.92
617	0.9
618	0.9
619	0.83
620	0.77
621	0.7
622	0.61
623	0.55
624	0.53
625	0.47
626	0.38
627	0.35
628	0.34
629	0.3
630	0.28
631	0.27
632	0.23
633	0.21
634	0.2
635	0.22
636	0.19
637	0.18
638	0.18
639	0.17
640	0.13
641	0.12
642	0.12
643	0.09
644	0.1
645	0.14
646	0.15
647	0.16
648	0.16
649	0.17
650	0.22
651	0.22
652	0.25

M5GBG5

3D AlphaFold-predicted Structure Viewer