Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5G8F8

Protein Details
Accession M5G8F8    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-44ESSKRGTTNQREKIKRKVAEHRHKSKKEAKKNVQWKSRKQKDPGBasic
NLS Segment(s)
PositionSequence
11-41REKIKRKVAEHRHKSKKEAKKNVQWKSRKQK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences ESSKRGTTNQREKIKRKVAEHRHKSKKEAKKNVQWKSRKQKDPGIPNSMPASMRAQVLAEVAEQRRIVGDLLPSIGPRSELT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.77
4 0.78
5 0.79
6 0.8
7 0.85
8 0.85
9 0.86
10 0.83
11 0.83
12 0.82
13 0.81
14 0.81
15 0.81
16 0.8
17 0.79
18 0.85
19 0.86
20 0.86
21 0.83
22 0.82
23 0.82
24 0.83
25 0.8
26 0.75
27 0.74
28 0.73
29 0.75
30 0.71
31 0.68
32 0.58
33 0.53
34 0.5
35 0.42
36 0.35
37 0.26
38 0.23
39 0.16
40 0.16
41 0.14
42 0.12
43 0.11
44 0.11
45 0.1
46 0.08
47 0.1
48 0.11
49 0.14
50 0.13
51 0.13
52 0.13
53 0.14
54 0.14
55 0.12
56 0.13
57 0.11
58 0.13
59 0.14
60 0.14
61 0.14
62 0.14