Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FSQ4

Protein Details
Accession M5FSQ4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-140SRRRGGDAGRGRRRRRKRVRRRKRRRKSTSTSTSRRRWMRBasic
NLS Segment(s)
PositionSequence
92-129KRKRWAMMESRRRGGDAGRGRRRRRKRVRRRKRRRKST
Subcellular Location(s) mito 17.5, mito_nucl 13.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MAVKSKSRQTRFPVARIKKIMQKDDEVGKVAQATPVLISKALEIFMQKLVDEAAHEAKSKGSRKVAAYHLKRTIESIDMFDFLKDLVETNQKRKRWAMMESRRRGGDAGRGRRRRRKRVRRRKRRRKSTSTSTSRRRWMRSMIEPAAESALCGESPLSPLAFGMRETTGVRTTAASACQGDDYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.75
4 0.73
5 0.69
6 0.71
7 0.7
8 0.63
9 0.6
10 0.56
11 0.56
12 0.52
13 0.47
14 0.39
15 0.32
16 0.29
17 0.24
18 0.2
19 0.14
20 0.12
21 0.1
22 0.12
23 0.12
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.09
31 0.1
32 0.11
33 0.12
34 0.1
35 0.1
36 0.1
37 0.09
38 0.09
39 0.1
40 0.11
41 0.12
42 0.13
43 0.13
44 0.15
45 0.22
46 0.25
47 0.27
48 0.28
49 0.31
50 0.32
51 0.38
52 0.43
53 0.47
54 0.48
55 0.5
56 0.52
57 0.49
58 0.47
59 0.43
60 0.36
61 0.28
62 0.24
63 0.2
64 0.14
65 0.14
66 0.14
67 0.12
68 0.11
69 0.08
70 0.07
71 0.05
72 0.05
73 0.06
74 0.14
75 0.16
76 0.25
77 0.31
78 0.32
79 0.35
80 0.36
81 0.39
82 0.34
83 0.4
84 0.42
85 0.47
86 0.56
87 0.58
88 0.6
89 0.55
90 0.51
91 0.45
92 0.35
93 0.33
94 0.32
95 0.38
96 0.45
97 0.53
98 0.6
99 0.7
100 0.79
101 0.81
102 0.84
103 0.85
104 0.87
105 0.9
106 0.94
107 0.96
108 0.97
109 0.97
110 0.97
111 0.97
112 0.96
113 0.96
114 0.94
115 0.93
116 0.92
117 0.91
118 0.89
119 0.87
120 0.83
121 0.82
122 0.79
123 0.73
124 0.67
125 0.64
126 0.63
127 0.62
128 0.64
129 0.58
130 0.53
131 0.48
132 0.44
133 0.38
134 0.29
135 0.21
136 0.13
137 0.11
138 0.08
139 0.08
140 0.08
141 0.06
142 0.08
143 0.1
144 0.09
145 0.08
146 0.08
147 0.1
148 0.1
149 0.1
150 0.11
151 0.11
152 0.13
153 0.14
154 0.17
155 0.17
156 0.17
157 0.18
158 0.16
159 0.18
160 0.18
161 0.19
162 0.18
163 0.17
164 0.18