Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FNI6

Protein Details
Accession M5FNI6   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
38-60RARFWTCRTTRKRQVYHPQQCDSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 6, nucl 5, extr 5, cyto_mito 5, mito 4
Family & Domain DBs
Amino Acid Sequences MTPLPLCISSSCSVSPLIACETRWGLSSCSRSFWPSSRARFWTCRTTRKRQVYHPQQCDSYFLNHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.13
4 0.15
5 0.14
6 0.14
7 0.15
8 0.16
9 0.16
10 0.17
11 0.17
12 0.15
13 0.19
14 0.24
15 0.23
16 0.23
17 0.24
18 0.24
19 0.24
20 0.25
21 0.27
22 0.28
23 0.33
24 0.36
25 0.39
26 0.42
27 0.46
28 0.47
29 0.51
30 0.5
31 0.56
32 0.58
33 0.64
34 0.7
35 0.75
36 0.77
37 0.77
38 0.82
39 0.83
40 0.87
41 0.84
42 0.79
43 0.73
44 0.67
45 0.62
46 0.53