Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F9G9

Protein Details
Accession A7F9G9    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-37QEVIETRKKRTKGKRVKLQGQFVFSHydrophilic
47-70EAEEKPKEKKPRGRPHKRPIEELEBasic
NLS Segment(s)
PositionSequence
19-29RKKRTKGKRVK
51-65KPKEKKPRGRPHKRP
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
KEGG ssl:SS1G_14250  -  
Amino Acid Sequences MILLYHQLLADAQEVIETRKKRTKGKRVKLQGQFVFSSKEVLKMVHEAEEKPKEKKPRGRPHKRPIEELEEETEEEEPESSSSDLELELDECVARRTRSHREN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.18
4 0.18
5 0.24
6 0.31
7 0.37
8 0.45
9 0.56
10 0.64
11 0.69
12 0.78
13 0.83
14 0.86
15 0.91
16 0.89
17 0.88
18 0.8
19 0.73
20 0.63
21 0.54
22 0.47
23 0.36
24 0.32
25 0.22
26 0.21
27 0.17
28 0.16
29 0.16
30 0.14
31 0.15
32 0.15
33 0.16
34 0.14
35 0.19
36 0.27
37 0.28
38 0.29
39 0.33
40 0.37
41 0.43
42 0.52
43 0.58
44 0.61
45 0.71
46 0.8
47 0.86
48 0.88
49 0.92
50 0.86
51 0.81
52 0.75
53 0.71
54 0.63
55 0.54
56 0.47
57 0.37
58 0.34
59 0.29
60 0.24
61 0.15
62 0.12
63 0.11
64 0.07
65 0.06
66 0.08
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.09
80 0.13
81 0.13
82 0.18
83 0.25