Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5G028

Protein Details
Accession M5G028    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
197-219QDKARREHKARLREKARDKGKTCBasic
227-254YPDPGCRARIRAERKRRRGRAPLHSAGPBasic
NLS Segment(s)
PositionSequence
193-217KRRTQDKARREHKARLREKARDKGK
234-247ARIRAERKRRRGRA
Subcellular Location(s) extr 13, plas 5, cyto 3, mito 2, cyto_nucl 2, E.R. 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021013  ATPase_Vma12  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF11712  Vma12  
Amino Acid Sequences MATLVSLPEHLRQTLLALLEVPPPPILTDDLATQLRPYVTPPGADPSLNLSPAPAPGAKPTIPNSLLSQVSKHVRSVRCRTALEANNLDPRDYEMIALLAGVRTISSATADPPETADTSRQNTAKQWAEDRRALTAVVNGLFSIGGVGFAVWYAAGSAGWGEEWRALLALFAGLVVAASEGILFVIWQDRIEKRRTQDKARREHKARLREKARDKGKTCTGGWSTRYPDPGCRARIRAERKRRRGRAPLHSAGPGCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.14
4 0.13
5 0.14
6 0.18
7 0.18
8 0.17
9 0.15
10 0.14
11 0.14
12 0.15
13 0.15
14 0.12
15 0.13
16 0.13
17 0.17
18 0.18
19 0.17
20 0.16
21 0.17
22 0.16
23 0.15
24 0.16
25 0.18
26 0.19
27 0.2
28 0.21
29 0.25
30 0.25
31 0.25
32 0.23
33 0.23
34 0.24
35 0.24
36 0.22
37 0.17
38 0.16
39 0.17
40 0.19
41 0.13
42 0.11
43 0.13
44 0.17
45 0.17
46 0.2
47 0.23
48 0.28
49 0.28
50 0.28
51 0.28
52 0.29
53 0.3
54 0.27
55 0.25
56 0.23
57 0.28
58 0.27
59 0.28
60 0.31
61 0.34
62 0.42
63 0.49
64 0.52
65 0.53
66 0.52
67 0.52
68 0.54
69 0.53
70 0.51
71 0.46
72 0.4
73 0.4
74 0.4
75 0.37
76 0.28
77 0.24
78 0.21
79 0.18
80 0.15
81 0.09
82 0.09
83 0.09
84 0.09
85 0.06
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.04
94 0.04
95 0.05
96 0.07
97 0.08
98 0.08
99 0.09
100 0.1
101 0.09
102 0.1
103 0.12
104 0.12
105 0.15
106 0.18
107 0.18
108 0.18
109 0.19
110 0.24
111 0.26
112 0.25
113 0.28
114 0.3
115 0.33
116 0.35
117 0.35
118 0.3
119 0.26
120 0.25
121 0.19
122 0.15
123 0.12
124 0.09
125 0.09
126 0.07
127 0.07
128 0.06
129 0.06
130 0.05
131 0.03
132 0.03
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.03
146 0.03
147 0.03
148 0.03
149 0.04
150 0.04
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.03
158 0.03
159 0.03
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.05
173 0.05
174 0.06
175 0.1
176 0.14
177 0.18
178 0.23
179 0.28
180 0.31
181 0.41
182 0.47
183 0.55
184 0.59
185 0.65
186 0.71
187 0.75
188 0.8
189 0.76
190 0.79
191 0.77
192 0.79
193 0.78
194 0.78
195 0.79
196 0.78
197 0.81
198 0.81
199 0.82
200 0.81
201 0.77
202 0.74
203 0.74
204 0.7
205 0.62
206 0.6
207 0.55
208 0.52
209 0.52
210 0.5
211 0.47
212 0.45
213 0.5
214 0.44
215 0.45
216 0.47
217 0.51
218 0.51
219 0.51
220 0.51
221 0.54
222 0.62
223 0.66
224 0.69
225 0.73
226 0.77
227 0.83
228 0.9
229 0.91
230 0.92
231 0.91
232 0.91
233 0.9
234 0.89
235 0.86
236 0.79
237 0.75