Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FPK0

Protein Details
Accession M5FPK0    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
237-257YESPADYKRRYKKEETDEMSKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, plas 3, nucl 1, extr 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR035437  SNase_OB-fold_sf  
IPR016071  Staphylococal_nuclease_OB-fold  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00565  SNase  
PROSITE View protein in PROSITE  
PS50830  TNASE_3  
Amino Acid Sequences MPTSWLSPSLTSPAKARHNLNARSIPSNLYVVLTTAAISSMFTLLGVRVYARYVRRIPSSEWVNPRILAEKRWIRGKVTSVGDADNFRLFHTPVLTRGRWRKVPQTAQELKDQTIHIRLAGVDAPELAHFGRPAQPYGQEALAWLKSMIEGKTVYCQLFRRDQYGRVVATCVVPRWYLPLWLRSGKCVELEMLRAGLATTYTQAGAEYGKWGVDEFQKVEEAAKKAKRGMWSKMSTYESPADYKRRYKKEETDEMSKAMEPEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.47
4 0.5
5 0.57
6 0.6
7 0.64
8 0.64
9 0.59
10 0.57
11 0.54
12 0.47
13 0.4
14 0.36
15 0.28
16 0.21
17 0.18
18 0.15
19 0.14
20 0.11
21 0.09
22 0.08
23 0.08
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.08
37 0.13
38 0.15
39 0.22
40 0.25
41 0.29
42 0.33
43 0.36
44 0.38
45 0.41
46 0.46
47 0.47
48 0.49
49 0.48
50 0.45
51 0.42
52 0.4
53 0.38
54 0.32
55 0.27
56 0.3
57 0.33
58 0.35
59 0.42
60 0.43
61 0.39
62 0.41
63 0.44
64 0.42
65 0.38
66 0.37
67 0.31
68 0.3
69 0.29
70 0.26
71 0.23
72 0.18
73 0.15
74 0.13
75 0.14
76 0.13
77 0.13
78 0.15
79 0.14
80 0.17
81 0.23
82 0.24
83 0.29
84 0.36
85 0.41
86 0.45
87 0.48
88 0.51
89 0.54
90 0.61
91 0.6
92 0.62
93 0.63
94 0.58
95 0.61
96 0.54
97 0.45
98 0.4
99 0.35
100 0.26
101 0.23
102 0.2
103 0.14
104 0.13
105 0.12
106 0.1
107 0.11
108 0.1
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.05
115 0.05
116 0.04
117 0.05
118 0.11
119 0.11
120 0.12
121 0.13
122 0.14
123 0.14
124 0.16
125 0.15
126 0.1
127 0.1
128 0.11
129 0.1
130 0.09
131 0.08
132 0.07
133 0.07
134 0.09
135 0.09
136 0.08
137 0.08
138 0.09
139 0.12
140 0.14
141 0.14
142 0.14
143 0.16
144 0.18
145 0.25
146 0.26
147 0.28
148 0.29
149 0.32
150 0.34
151 0.36
152 0.33
153 0.26
154 0.26
155 0.22
156 0.22
157 0.2
158 0.16
159 0.13
160 0.13
161 0.12
162 0.15
163 0.15
164 0.18
165 0.19
166 0.22
167 0.25
168 0.32
169 0.32
170 0.31
171 0.33
172 0.28
173 0.27
174 0.23
175 0.2
176 0.15
177 0.17
178 0.15
179 0.13
180 0.11
181 0.11
182 0.1
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.07
192 0.07
193 0.07
194 0.08
195 0.08
196 0.08
197 0.08
198 0.08
199 0.1
200 0.13
201 0.16
202 0.16
203 0.17
204 0.18
205 0.18
206 0.21
207 0.24
208 0.24
209 0.29
210 0.33
211 0.34
212 0.37
213 0.41
214 0.47
215 0.47
216 0.52
217 0.54
218 0.55
219 0.56
220 0.59
221 0.6
222 0.53
223 0.51
224 0.47
225 0.4
226 0.39
227 0.4
228 0.41
229 0.42
230 0.51
231 0.57
232 0.62
233 0.67
234 0.72
235 0.76
236 0.78
237 0.83
238 0.8
239 0.78
240 0.72
241 0.66
242 0.59
243 0.5