Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5FYR9

Protein Details
Accession M5FYR9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-56EVKRKGRPQTQCERCRQRRKRDRSHVRCDCLTKBasic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences YYSATCIKGHRSANCAHNTRPLFEVKRKGRPQTQCERCRQRRKRDRSHVRCDCLTKLEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.52
3 0.46
4 0.49
5 0.46
6 0.44
7 0.4
8 0.39
9 0.35
10 0.37
11 0.46
12 0.43
13 0.52
14 0.55
15 0.58
16 0.6
17 0.63
18 0.65
19 0.66
20 0.7
21 0.68
22 0.73
23 0.79
24 0.81
25 0.85
26 0.87
27 0.87
28 0.88
29 0.91
30 0.92
31 0.92
32 0.94
33 0.92
34 0.94
35 0.92
36 0.88
37 0.84
38 0.78
39 0.7