Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EPW1

Protein Details
Accession A7EPW1    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-47DIPDSSPSRPSKRRKKDMRINVGRHSAEHydrophilic
NLS Segment(s)
PositionSequence
10-13RPRR
26-36PSRPSKRRKKD
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
KEGG ssl:SS1G_07360  -  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS50039  FORK_HEAD_3  
Amino Acid Sequences MPSSGKRAQRPRREPMMKVDIPDSSPSRPSKRRKKDMRINVGRHSAEAEGQDEGPIIDNGAPQAIAPAPQGYQRPGTPPPASRIKIPGSNKRSPPAYSAGGTMVMNDSESVDLSLDSNAHIKPGYSYSQMIAQAIIGTPGETLVLNGIYQYIMRRYAYYRHQPPHGWQVSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.76
3 0.75
4 0.66
5 0.6
6 0.53
7 0.44
8 0.39
9 0.4
10 0.34
11 0.26
12 0.3
13 0.34
14 0.41
15 0.48
16 0.57
17 0.63
18 0.71
19 0.79
20 0.84
21 0.89
22 0.91
23 0.93
24 0.94
25 0.93
26 0.88
27 0.83
28 0.8
29 0.69
30 0.59
31 0.49
32 0.38
33 0.29
34 0.24
35 0.19
36 0.12
37 0.12
38 0.11
39 0.09
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.04
50 0.05
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.09
57 0.11
58 0.11
59 0.13
60 0.13
61 0.17
62 0.18
63 0.23
64 0.23
65 0.24
66 0.27
67 0.32
68 0.33
69 0.3
70 0.33
71 0.3
72 0.34
73 0.38
74 0.43
75 0.42
76 0.47
77 0.48
78 0.47
79 0.47
80 0.41
81 0.39
82 0.34
83 0.29
84 0.23
85 0.22
86 0.19
87 0.18
88 0.17
89 0.14
90 0.1
91 0.07
92 0.07
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.08
105 0.07
106 0.08
107 0.08
108 0.08
109 0.09
110 0.12
111 0.14
112 0.15
113 0.16
114 0.16
115 0.2
116 0.21
117 0.19
118 0.16
119 0.13
120 0.11
121 0.1
122 0.1
123 0.06
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.06
132 0.05
133 0.06
134 0.06
135 0.06
136 0.06
137 0.09
138 0.1
139 0.13
140 0.14
141 0.16
142 0.19
143 0.26
144 0.35
145 0.44
146 0.51
147 0.54
148 0.59
149 0.61
150 0.65
151 0.69