Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EF34

Protein Details
Accession A7EF34    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-52DDTERRTAKRSRFDQKEPEPKRTSRFDRRSRSPPARKVESRRSRSPLARRTBasic
NLS Segment(s)
PositionSequence
8-63TAKRSRFDQKEPEPKRTSRFDRRSRSPPARKVESRRSRSPLARRTSRSPAPDSAKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004087  KH_dom  
IPR004088  KH_dom_type_1  
IPR036612  KH_dom_type_1_sf  
IPR031121  RIK/BLOM7  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
KEGG ssl:SS1G_03925  -  
Pfam View protein in Pfam  
PF00013  KH_1  
PROSITE View protein in PROSITE  
PS50084  KH_TYPE_1  
CDD cd22385  KH-I_KHDC4_rpt1  
cd22386  KH-I_KHDC4_rpt2  
Amino Acid Sequences MDDTERRTAKRSRFDQKEPEPKRTSRFDRRSRSPPARKVESRRSRSPLARRTSRSPAPDSAKKNGADPAAAAAAAAAKINAQIQAKKGIQHADVPPIRATESPVGKSASPGTPGPGAGNSASNINGEMYIADGDYIKDIEVNDLRNRYTLTKGSTQKMIKEETGADVTTRGNYYPDKSMATAANPPLYLHVTSQTKRGLEQAVQKIEELMKQELPNLVDERRFRRREPEQVERDEFGRRKWPEEKIAIDFEPIPGFNLRAQVVGHGGAYVKHIQQETRCRVQIKGRGSGFMEHGTGRESDEDMYLHVAGPDPNEVQKAKELCEDLLKNVREQYEEFKARPPQQRGYGQGTGYSGERGYGDRAPDRSNSYGGGYNNYNKSPAPNTPNAGSPSTPGDYGSAHAAQYYATGADPYAQYGGYEAYVQYYQQYMAAMAQYQQQQQGAPGSGPPPPPSEAPPPPPGGSAPPPPSGPPPGSNNSYSAVPPPPGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.85
4 0.87
5 0.83
6 0.83
7 0.8
8 0.77
9 0.75
10 0.75
11 0.74
12 0.74
13 0.79
14 0.79
15 0.82
16 0.85
17 0.87
18 0.87
19 0.88
20 0.87
21 0.86
22 0.85
23 0.85
24 0.85
25 0.86
26 0.86
27 0.86
28 0.84
29 0.83
30 0.81
31 0.8
32 0.8
33 0.81
34 0.79
35 0.78
36 0.79
37 0.77
38 0.77
39 0.78
40 0.75
41 0.71
42 0.68
43 0.66
44 0.65
45 0.67
46 0.66
47 0.63
48 0.63
49 0.57
50 0.53
51 0.49
52 0.42
53 0.34
54 0.29
55 0.24
56 0.18
57 0.17
58 0.15
59 0.1
60 0.09
61 0.09
62 0.08
63 0.05
64 0.04
65 0.06
66 0.07
67 0.11
68 0.13
69 0.16
70 0.18
71 0.26
72 0.27
73 0.3
74 0.32
75 0.33
76 0.31
77 0.35
78 0.36
79 0.38
80 0.38
81 0.38
82 0.35
83 0.32
84 0.32
85 0.26
86 0.27
87 0.24
88 0.27
89 0.26
90 0.28
91 0.29
92 0.27
93 0.28
94 0.28
95 0.23
96 0.22
97 0.2
98 0.2
99 0.2
100 0.2
101 0.19
102 0.16
103 0.15
104 0.13
105 0.14
106 0.12
107 0.11
108 0.11
109 0.1
110 0.1
111 0.09
112 0.08
113 0.07
114 0.06
115 0.06
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.06
123 0.05
124 0.06
125 0.06
126 0.1
127 0.12
128 0.16
129 0.19
130 0.21
131 0.21
132 0.21
133 0.23
134 0.21
135 0.23
136 0.23
137 0.24
138 0.3
139 0.35
140 0.37
141 0.43
142 0.42
143 0.43
144 0.43
145 0.41
146 0.33
147 0.3
148 0.28
149 0.23
150 0.23
151 0.18
152 0.15
153 0.13
154 0.13
155 0.12
156 0.12
157 0.09
158 0.1
159 0.11
160 0.14
161 0.16
162 0.18
163 0.18
164 0.18
165 0.2
166 0.19
167 0.19
168 0.21
169 0.18
170 0.18
171 0.17
172 0.16
173 0.15
174 0.16
175 0.15
176 0.11
177 0.16
178 0.19
179 0.2
180 0.24
181 0.25
182 0.24
183 0.24
184 0.26
185 0.22
186 0.21
187 0.29
188 0.31
189 0.31
190 0.31
191 0.3
192 0.29
193 0.27
194 0.25
195 0.2
196 0.15
197 0.15
198 0.15
199 0.16
200 0.17
201 0.17
202 0.17
203 0.16
204 0.16
205 0.17
206 0.2
207 0.25
208 0.32
209 0.35
210 0.33
211 0.4
212 0.45
213 0.51
214 0.56
215 0.6
216 0.56
217 0.59
218 0.61
219 0.53
220 0.48
221 0.44
222 0.38
223 0.29
224 0.31
225 0.27
226 0.29
227 0.33
228 0.36
229 0.35
230 0.38
231 0.39
232 0.33
233 0.35
234 0.31
235 0.27
236 0.23
237 0.18
238 0.14
239 0.12
240 0.1
241 0.07
242 0.08
243 0.08
244 0.1
245 0.1
246 0.1
247 0.1
248 0.1
249 0.1
250 0.1
251 0.09
252 0.06
253 0.06
254 0.06
255 0.08
256 0.09
257 0.09
258 0.11
259 0.11
260 0.13
261 0.18
262 0.27
263 0.31
264 0.35
265 0.37
266 0.36
267 0.38
268 0.44
269 0.46
270 0.41
271 0.43
272 0.37
273 0.36
274 0.36
275 0.35
276 0.3
277 0.24
278 0.21
279 0.13
280 0.13
281 0.12
282 0.11
283 0.1
284 0.09
285 0.09
286 0.08
287 0.09
288 0.09
289 0.08
290 0.09
291 0.08
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.09
298 0.08
299 0.09
300 0.12
301 0.12
302 0.12
303 0.17
304 0.18
305 0.17
306 0.2
307 0.21
308 0.19
309 0.25
310 0.25
311 0.23
312 0.3
313 0.29
314 0.26
315 0.28
316 0.28
317 0.23
318 0.24
319 0.26
320 0.28
321 0.31
322 0.3
323 0.34
324 0.4
325 0.47
326 0.54
327 0.55
328 0.52
329 0.56
330 0.6
331 0.6
332 0.6
333 0.56
334 0.47
335 0.43
336 0.37
337 0.3
338 0.25
339 0.21
340 0.13
341 0.1
342 0.1
343 0.1
344 0.12
345 0.13
346 0.16
347 0.19
348 0.22
349 0.23
350 0.25
351 0.29
352 0.28
353 0.27
354 0.25
355 0.24
356 0.26
357 0.24
358 0.26
359 0.24
360 0.28
361 0.3
362 0.3
363 0.29
364 0.24
365 0.28
366 0.28
367 0.32
368 0.33
369 0.35
370 0.38
371 0.38
372 0.43
373 0.42
374 0.4
375 0.33
376 0.27
377 0.27
378 0.25
379 0.23
380 0.19
381 0.17
382 0.15
383 0.16
384 0.18
385 0.15
386 0.13
387 0.13
388 0.12
389 0.11
390 0.11
391 0.1
392 0.07
393 0.06
394 0.06
395 0.06
396 0.08
397 0.09
398 0.09
399 0.09
400 0.09
401 0.09
402 0.09
403 0.1
404 0.08
405 0.09
406 0.08
407 0.09
408 0.1
409 0.1
410 0.11
411 0.11
412 0.11
413 0.11
414 0.11
415 0.09
416 0.1
417 0.11
418 0.11
419 0.11
420 0.16
421 0.19
422 0.21
423 0.23
424 0.22
425 0.22
426 0.23
427 0.27
428 0.23
429 0.19
430 0.19
431 0.18
432 0.22
433 0.25
434 0.25
435 0.24
436 0.26
437 0.27
438 0.3
439 0.38
440 0.41
441 0.44
442 0.48
443 0.49
444 0.48
445 0.47
446 0.43
447 0.41
448 0.39
449 0.42
450 0.41
451 0.39
452 0.39
453 0.41
454 0.44
455 0.44
456 0.42
457 0.38
458 0.41
459 0.44
460 0.47
461 0.47
462 0.44
463 0.4
464 0.38
465 0.34
466 0.31
467 0.29