Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FN58

Protein Details
Accession M5FN58    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
194-219VLSAVKGWRGWRRKRRGLEPEGEPKEBasic
NLS Segment(s)
PositionSequence
202-210RGWRRKRRG
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023214  HAD_sf  
IPR027706  PGP_Pase  
Gene Ontology GO:0008962  F:phosphatidylglycerophosphatase activity  
Pfam View protein in Pfam  
PF09419  PGP_phosphatase  
Amino Acid Sequences MPIIRHVFTALRIITKPSVLVPNLAVKSVANINFANLREAGYEGVVIDRDNCLTKPRQDVLVPSLKDAWSSCLESFPPSRVLIVSNSAGTSKDASFLQAEALTRNLGVPVMLHEAPKPWVKRPPTPSAEGVSTDTKPVQPRKVPTPRLVVIGDRLSTDIVLGARLPKSFSIWTTQVWEEESAGVRIVRLVEGSVLSAVKGWRGWRRKRRGLEPEGEPKEFVIDVPVAPQPEKKSMVEFCPISSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.22
5 0.27
6 0.24
7 0.25
8 0.23
9 0.29
10 0.29
11 0.29
12 0.25
13 0.19
14 0.21
15 0.25
16 0.24
17 0.19
18 0.19
19 0.2
20 0.24
21 0.25
22 0.24
23 0.18
24 0.18
25 0.15
26 0.16
27 0.15
28 0.1
29 0.1
30 0.08
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.08
37 0.1
38 0.1
39 0.14
40 0.19
41 0.23
42 0.3
43 0.31
44 0.34
45 0.34
46 0.37
47 0.39
48 0.42
49 0.38
50 0.32
51 0.32
52 0.28
53 0.28
54 0.25
55 0.22
56 0.16
57 0.19
58 0.18
59 0.17
60 0.18
61 0.2
62 0.21
63 0.19
64 0.19
65 0.16
66 0.16
67 0.15
68 0.16
69 0.14
70 0.16
71 0.15
72 0.12
73 0.12
74 0.12
75 0.12
76 0.11
77 0.12
78 0.09
79 0.1
80 0.09
81 0.1
82 0.1
83 0.1
84 0.1
85 0.09
86 0.1
87 0.08
88 0.09
89 0.08
90 0.07
91 0.07
92 0.06
93 0.05
94 0.05
95 0.04
96 0.05
97 0.09
98 0.09
99 0.09
100 0.1
101 0.11
102 0.13
103 0.18
104 0.18
105 0.17
106 0.24
107 0.28
108 0.35
109 0.4
110 0.46
111 0.45
112 0.47
113 0.46
114 0.42
115 0.38
116 0.32
117 0.29
118 0.22
119 0.19
120 0.16
121 0.15
122 0.15
123 0.19
124 0.23
125 0.26
126 0.28
127 0.32
128 0.41
129 0.5
130 0.53
131 0.52
132 0.55
133 0.5
134 0.49
135 0.45
136 0.36
137 0.3
138 0.27
139 0.23
140 0.16
141 0.15
142 0.12
143 0.11
144 0.1
145 0.08
146 0.06
147 0.06
148 0.06
149 0.08
150 0.09
151 0.09
152 0.1
153 0.09
154 0.12
155 0.13
156 0.14
157 0.17
158 0.18
159 0.19
160 0.22
161 0.23
162 0.21
163 0.21
164 0.2
165 0.15
166 0.15
167 0.15
168 0.11
169 0.11
170 0.1
171 0.09
172 0.09
173 0.09
174 0.08
175 0.07
176 0.07
177 0.06
178 0.07
179 0.07
180 0.07
181 0.07
182 0.06
183 0.08
184 0.08
185 0.09
186 0.11
187 0.15
188 0.24
189 0.34
190 0.45
191 0.54
192 0.64
193 0.73
194 0.8
195 0.86
196 0.87
197 0.86
198 0.83
199 0.81
200 0.81
201 0.77
202 0.69
203 0.58
204 0.48
205 0.41
206 0.33
207 0.25
208 0.17
209 0.13
210 0.11
211 0.14
212 0.16
213 0.16
214 0.17
215 0.22
216 0.23
217 0.28
218 0.32
219 0.31
220 0.35
221 0.37
222 0.4
223 0.44
224 0.4
225 0.35