Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G8R7

Protein Details
Accession M5G8R7   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
276-304MITKQWETPKIRGHRRRRRGGIRYLIPAWHydrophilic
NLS Segment(s)
PositionSequence
285-296KIRGHRRRRRGG
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015915  Kelch-typ_b-propeller  
Pfam View protein in Pfam  
PF13854  Kelch_5  
Amino Acid Sequences MKPVLGYHEGCLKSHSNRSYHFNLSDTAISFFGGYDSKETVEDVWVLDTEMREWERVEMRGEGPGPLRAHTAVGDERYIFVFGGGSGDESSDELWARDTFEQTWHLFPCSTTSPVPRRAHNSFIYDEHLYVYGGGSGHDALSDLWRIDVSWAALARSKDEPLVWEELQTSGSAPSDMPVPGEEGSPEESKPRAKGCTSATLVGNVLVVLGGQSGRDGDGEGPWGDCWVLNLDDLHWEEKHLNPPIPLASHTATLVGTYLFIFGGNDGSRYCNELNMITKQWETPKIRGHRRRRRGGIRYLIPAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.42
4 0.45
5 0.52
6 0.54
7 0.56
8 0.52
9 0.45
10 0.4
11 0.38
12 0.37
13 0.31
14 0.26
15 0.2
16 0.18
17 0.16
18 0.14
19 0.12
20 0.1
21 0.1
22 0.1
23 0.11
24 0.12
25 0.12
26 0.13
27 0.12
28 0.13
29 0.13
30 0.11
31 0.11
32 0.1
33 0.1
34 0.11
35 0.1
36 0.09
37 0.13
38 0.13
39 0.13
40 0.14
41 0.17
42 0.19
43 0.21
44 0.23
45 0.21
46 0.21
47 0.24
48 0.23
49 0.22
50 0.2
51 0.24
52 0.22
53 0.2
54 0.21
55 0.18
56 0.18
57 0.17
58 0.19
59 0.16
60 0.16
61 0.16
62 0.15
63 0.15
64 0.15
65 0.15
66 0.11
67 0.09
68 0.07
69 0.06
70 0.07
71 0.06
72 0.06
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.08
82 0.08
83 0.1
84 0.11
85 0.12
86 0.12
87 0.14
88 0.18
89 0.17
90 0.2
91 0.18
92 0.18
93 0.17
94 0.16
95 0.18
96 0.17
97 0.19
98 0.18
99 0.24
100 0.28
101 0.37
102 0.4
103 0.4
104 0.44
105 0.44
106 0.48
107 0.45
108 0.43
109 0.36
110 0.35
111 0.35
112 0.28
113 0.25
114 0.2
115 0.17
116 0.13
117 0.11
118 0.09
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.04
128 0.05
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.05
137 0.06
138 0.06
139 0.06
140 0.1
141 0.1
142 0.12
143 0.12
144 0.12
145 0.11
146 0.11
147 0.12
148 0.11
149 0.16
150 0.14
151 0.13
152 0.13
153 0.13
154 0.14
155 0.12
156 0.1
157 0.06
158 0.06
159 0.06
160 0.05
161 0.05
162 0.06
163 0.06
164 0.06
165 0.06
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.11
172 0.11
173 0.11
174 0.11
175 0.13
176 0.15
177 0.17
178 0.19
179 0.2
180 0.19
181 0.24
182 0.26
183 0.33
184 0.33
185 0.33
186 0.31
187 0.28
188 0.28
189 0.23
190 0.19
191 0.11
192 0.08
193 0.05
194 0.04
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.04
202 0.04
203 0.05
204 0.05
205 0.06
206 0.08
207 0.08
208 0.09
209 0.08
210 0.09
211 0.08
212 0.07
213 0.08
214 0.09
215 0.09
216 0.09
217 0.09
218 0.09
219 0.13
220 0.15
221 0.16
222 0.13
223 0.14
224 0.15
225 0.19
226 0.26
227 0.27
228 0.28
229 0.26
230 0.28
231 0.29
232 0.29
233 0.26
234 0.24
235 0.2
236 0.19
237 0.19
238 0.18
239 0.15
240 0.14
241 0.13
242 0.08
243 0.07
244 0.06
245 0.06
246 0.05
247 0.06
248 0.06
249 0.05
250 0.1
251 0.09
252 0.1
253 0.1
254 0.13
255 0.14
256 0.18
257 0.18
258 0.16
259 0.17
260 0.2
261 0.24
262 0.26
263 0.29
264 0.27
265 0.27
266 0.29
267 0.33
268 0.39
269 0.4
270 0.42
271 0.49
272 0.57
273 0.67
274 0.74
275 0.8
276 0.82
277 0.87
278 0.91
279 0.92
280 0.93
281 0.91
282 0.91
283 0.91
284 0.86