Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5FWW5

Protein Details
Accession M5FWW5    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-61KATPDKTTPKPSKRKSGKTNTNKNKSKPDHydrophilic
NLS Segment(s)
PositionSequence
28-69KPKPDKATPDKTTPKPSKRKSGKTNTNKNKSKPDQGNPDKTK
Subcellular Location(s) nucl 18.5, mito_nucl 12, mito 4.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSMVGSHAMAAARALVNRETGIDILGPKPKPDKATPDKTTPKPSKRKSGKTNTNKNKSKPDQGNPDKTKPGKVHPDKETDEEYQDKVNSNLRLRLFQIREVDENTQLVDMPEGGRGTGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.12
5 0.13
6 0.12
7 0.11
8 0.11
9 0.1
10 0.11
11 0.12
12 0.18
13 0.18
14 0.18
15 0.22
16 0.25
17 0.29
18 0.32
19 0.39
20 0.42
21 0.52
22 0.54
23 0.6
24 0.66
25 0.65
26 0.72
27 0.71
28 0.72
29 0.72
30 0.74
31 0.75
32 0.77
33 0.82
34 0.82
35 0.83
36 0.84
37 0.84
38 0.89
39 0.89
40 0.9
41 0.86
42 0.8
43 0.79
44 0.73
45 0.72
46 0.68
47 0.64
48 0.64
49 0.65
50 0.72
51 0.66
52 0.66
53 0.63
54 0.57
55 0.56
56 0.48
57 0.47
58 0.48
59 0.5
60 0.54
61 0.52
62 0.58
63 0.55
64 0.56
65 0.53
66 0.43
67 0.39
68 0.33
69 0.3
70 0.25
71 0.24
72 0.21
73 0.19
74 0.24
75 0.26
76 0.27
77 0.31
78 0.3
79 0.32
80 0.34
81 0.41
82 0.37
83 0.37
84 0.4
85 0.37
86 0.39
87 0.39
88 0.39
89 0.32
90 0.3
91 0.26
92 0.2
93 0.17
94 0.15
95 0.12
96 0.1
97 0.08
98 0.11
99 0.11