Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G509

Protein Details
Accession M5G509   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
161-180EENAEKPAKKKKQKLVCSYAHydrophilic
NLS Segment(s)
PositionSequence
168-172AKKKK
Subcellular Location(s) mito 16, cyto_mito 12.833, mito_nucl 9.833, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MAKPSTHKSAAKPVLPKDKHTMLKMAAVIVARMHEDAEDPRFLPSVKYPDVAPFGNTVVLLLNSPQSALICDLPKKWVRLFTLDQQEELTTLSAPPEEEEEKDKDEKVFKAMLSSFSMTLGSLASLLVKAKKAHLVKGTAPPPASVEDLFIPETPEPEPVEENAEKPAKKKKQKLVCSYALVKPKKCEQEDNEDSAGPSTKRSCFLEAKIELPVMPLHMAEHKMLKLWKSLHMAQKAVDAVQKVMDTVMGWADQVQTLLGRALAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.65
4 0.62
5 0.63
6 0.63
7 0.59
8 0.56
9 0.47
10 0.5
11 0.45
12 0.38
13 0.31
14 0.25
15 0.22
16 0.17
17 0.16
18 0.11
19 0.11
20 0.1
21 0.08
22 0.1
23 0.12
24 0.15
25 0.16
26 0.15
27 0.16
28 0.17
29 0.17
30 0.18
31 0.2
32 0.24
33 0.24
34 0.25
35 0.25
36 0.28
37 0.32
38 0.3
39 0.25
40 0.2
41 0.18
42 0.18
43 0.17
44 0.13
45 0.1
46 0.09
47 0.08
48 0.07
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.09
56 0.12
57 0.13
58 0.15
59 0.16
60 0.22
61 0.25
62 0.27
63 0.28
64 0.3
65 0.3
66 0.35
67 0.38
68 0.4
69 0.47
70 0.44
71 0.43
72 0.37
73 0.35
74 0.29
75 0.25
76 0.17
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.09
84 0.09
85 0.1
86 0.14
87 0.15
88 0.18
89 0.19
90 0.2
91 0.19
92 0.22
93 0.21
94 0.2
95 0.2
96 0.17
97 0.19
98 0.19
99 0.19
100 0.18
101 0.19
102 0.16
103 0.14
104 0.14
105 0.1
106 0.1
107 0.07
108 0.05
109 0.04
110 0.04
111 0.03
112 0.04
113 0.04
114 0.05
115 0.07
116 0.08
117 0.09
118 0.15
119 0.16
120 0.2
121 0.23
122 0.25
123 0.26
124 0.33
125 0.34
126 0.3
127 0.29
128 0.25
129 0.23
130 0.21
131 0.2
132 0.13
133 0.12
134 0.1
135 0.11
136 0.12
137 0.1
138 0.1
139 0.09
140 0.1
141 0.09
142 0.1
143 0.1
144 0.1
145 0.11
146 0.1
147 0.15
148 0.15
149 0.15
150 0.18
151 0.21
152 0.21
153 0.23
154 0.33
155 0.37
156 0.46
157 0.55
158 0.59
159 0.66
160 0.75
161 0.82
162 0.8
163 0.76
164 0.72
165 0.67
166 0.63
167 0.62
168 0.57
169 0.5
170 0.46
171 0.47
172 0.51
173 0.49
174 0.52
175 0.47
176 0.53
177 0.55
178 0.57
179 0.51
180 0.42
181 0.39
182 0.32
183 0.31
184 0.2
185 0.18
186 0.17
187 0.18
188 0.21
189 0.24
190 0.28
191 0.3
192 0.33
193 0.39
194 0.37
195 0.36
196 0.34
197 0.32
198 0.26
199 0.23
200 0.2
201 0.12
202 0.11
203 0.1
204 0.09
205 0.12
206 0.14
207 0.14
208 0.17
209 0.16
210 0.2
211 0.22
212 0.23
213 0.26
214 0.27
215 0.32
216 0.35
217 0.41
218 0.46
219 0.48
220 0.48
221 0.42
222 0.45
223 0.39
224 0.34
225 0.3
226 0.23
227 0.19
228 0.19
229 0.19
230 0.14
231 0.13
232 0.12
233 0.1
234 0.09
235 0.1
236 0.08
237 0.08
238 0.08
239 0.09
240 0.09
241 0.09
242 0.09
243 0.08
244 0.08
245 0.09