Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G352

Protein Details
Accession M5G352   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-127KRLKMLPELKNWKKKQKKLWELFTHHALHydrophilic
NLS Segment(s)
PositionSequence
107-117ELKNWKKKQKK
Subcellular Location(s) nucl 11, mito 11, mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MIWLHMQEPLLERALCLLCSLTKSKLQEELQADNNQQEIALQDEKQMLAWQGLQPYAIMPILQYIMNFSKPHKWQQQVLLTFTLTKMQYLAQHTKHRYLKRLKMLPELKNWKKKQKKLWELFTHHALGIKIRSSNML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.16
4 0.14
5 0.12
6 0.15
7 0.19
8 0.17
9 0.21
10 0.24
11 0.26
12 0.33
13 0.33
14 0.37
15 0.39
16 0.4
17 0.4
18 0.41
19 0.39
20 0.32
21 0.31
22 0.23
23 0.19
24 0.14
25 0.09
26 0.1
27 0.11
28 0.1
29 0.12
30 0.13
31 0.13
32 0.13
33 0.13
34 0.1
35 0.09
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.09
42 0.08
43 0.08
44 0.07
45 0.06
46 0.04
47 0.05
48 0.06
49 0.06
50 0.05
51 0.07
52 0.08
53 0.1
54 0.11
55 0.11
56 0.18
57 0.2
58 0.28
59 0.33
60 0.34
61 0.36
62 0.43
63 0.5
64 0.45
65 0.45
66 0.38
67 0.31
68 0.29
69 0.25
70 0.22
71 0.14
72 0.11
73 0.1
74 0.1
75 0.14
76 0.19
77 0.26
78 0.28
79 0.36
80 0.39
81 0.47
82 0.54
83 0.54
84 0.58
85 0.61
86 0.64
87 0.66
88 0.7
89 0.65
90 0.68
91 0.72
92 0.68
93 0.69
94 0.7
95 0.69
96 0.73
97 0.76
98 0.77
99 0.79
100 0.83
101 0.83
102 0.84
103 0.86
104 0.85
105 0.89
106 0.88
107 0.86
108 0.82
109 0.76
110 0.67
111 0.56
112 0.5
113 0.39
114 0.33
115 0.29
116 0.27
117 0.23