Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5G8Q9

Protein Details
Accession M5G8Q9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
126-152RQVLRSLFRRPKKRYLRAKPVRRELITHydrophilic
NLS Segment(s)
PositionSequence
133-148FRRPKKRYLRAKPVRR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAIKSSSRLELPISQFCSLVSRCPQLRYIHVPFSLDFPRGLLPDARLVVPKLQYLFAEGLNCSDMASAKAYIPLNLPKLDRVLATGIDNKVQEVLDDLRITFNFPDADTLADLRLQLAGDEQPLRRQVLRSLFRRPKKRYLRAKPVRRELITIKQERTDETLFDDQPEDQVLEIRLTDLELPILVEPPPSPRTILSASDIPSAFRSSVSSLSEESPPSATSIYVSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.34
4 0.36
5 0.29
6 0.3
7 0.28
8 0.31
9 0.33
10 0.36
11 0.42
12 0.4
13 0.46
14 0.48
15 0.49
16 0.47
17 0.46
18 0.45
19 0.4
20 0.41
21 0.37
22 0.29
23 0.23
24 0.18
25 0.19
26 0.18
27 0.2
28 0.16
29 0.15
30 0.18
31 0.2
32 0.19
33 0.19
34 0.19
35 0.21
36 0.21
37 0.21
38 0.18
39 0.18
40 0.17
41 0.18
42 0.18
43 0.16
44 0.16
45 0.13
46 0.13
47 0.12
48 0.12
49 0.09
50 0.08
51 0.08
52 0.07
53 0.09
54 0.09
55 0.08
56 0.13
57 0.13
58 0.14
59 0.16
60 0.19
61 0.2
62 0.21
63 0.22
64 0.18
65 0.19
66 0.19
67 0.17
68 0.14
69 0.13
70 0.12
71 0.13
72 0.16
73 0.15
74 0.16
75 0.16
76 0.14
77 0.14
78 0.13
79 0.11
80 0.09
81 0.1
82 0.1
83 0.1
84 0.1
85 0.11
86 0.11
87 0.12
88 0.09
89 0.09
90 0.08
91 0.08
92 0.09
93 0.08
94 0.09
95 0.08
96 0.08
97 0.07
98 0.07
99 0.07
100 0.05
101 0.05
102 0.05
103 0.04
104 0.05
105 0.05
106 0.06
107 0.08
108 0.08
109 0.1
110 0.12
111 0.14
112 0.14
113 0.14
114 0.18
115 0.25
116 0.32
117 0.34
118 0.43
119 0.5
120 0.57
121 0.67
122 0.68
123 0.69
124 0.73
125 0.8
126 0.8
127 0.82
128 0.86
129 0.87
130 0.91
131 0.89
132 0.88
133 0.86
134 0.75
135 0.69
136 0.63
137 0.62
138 0.61
139 0.56
140 0.48
141 0.44
142 0.43
143 0.4
144 0.41
145 0.31
146 0.23
147 0.24
148 0.27
149 0.23
150 0.24
151 0.23
152 0.18
153 0.17
154 0.18
155 0.12
156 0.08
157 0.1
158 0.1
159 0.09
160 0.09
161 0.09
162 0.08
163 0.08
164 0.09
165 0.07
166 0.06
167 0.06
168 0.07
169 0.06
170 0.07
171 0.07
172 0.07
173 0.07
174 0.13
175 0.15
176 0.15
177 0.16
178 0.15
179 0.2
180 0.23
181 0.25
182 0.24
183 0.26
184 0.27
185 0.31
186 0.3
187 0.27
188 0.25
189 0.25
190 0.21
191 0.17
192 0.18
193 0.16
194 0.19
195 0.2
196 0.2
197 0.2
198 0.22
199 0.25
200 0.24
201 0.23
202 0.2
203 0.19
204 0.18
205 0.17
206 0.14