Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G1C1

Protein Details
Accession M5G1C1   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-51IEEPTKKPANKKKQKLMHTYAPHydrophilic
NLS Segment(s)
PositionSequence
35-44KKPANKKKQK
Subcellular Location(s) mito 13, cyto_mito 10.333, mito_nucl 9.833, cyto 6.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MCIACIKKVAVLPPAPAEKKLFPSETPEPIEEPTKKPANKKKQKLMHTYAPAKPKKCKQEDDKDEPGPSQKQSRLPEAEIKSPVAPLCMVEHKMLELHKSLQMAQKVVDVAQKAVDRGVAWAEQIQTLLGQALAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.37
4 0.38
5 0.34
6 0.38
7 0.41
8 0.38
9 0.31
10 0.37
11 0.4
12 0.41
13 0.42
14 0.37
15 0.34
16 0.33
17 0.39
18 0.34
19 0.32
20 0.33
21 0.37
22 0.39
23 0.47
24 0.56
25 0.61
26 0.68
27 0.75
28 0.78
29 0.79
30 0.85
31 0.84
32 0.81
33 0.78
34 0.76
35 0.73
36 0.67
37 0.68
38 0.65
39 0.59
40 0.59
41 0.58
42 0.59
43 0.59
44 0.63
45 0.62
46 0.68
47 0.73
48 0.74
49 0.74
50 0.66
51 0.59
52 0.52
53 0.46
54 0.36
55 0.29
56 0.26
57 0.22
58 0.27
59 0.29
60 0.34
61 0.34
62 0.34
63 0.4
64 0.38
65 0.39
66 0.33
67 0.32
68 0.26
69 0.25
70 0.23
71 0.15
72 0.13
73 0.09
74 0.11
75 0.13
76 0.14
77 0.14
78 0.14
79 0.13
80 0.15
81 0.15
82 0.14
83 0.13
84 0.13
85 0.15
86 0.16
87 0.18
88 0.21
89 0.23
90 0.22
91 0.21
92 0.21
93 0.19
94 0.19
95 0.2
96 0.16
97 0.14
98 0.17
99 0.18
100 0.16
101 0.16
102 0.16
103 0.13
104 0.13
105 0.15
106 0.11
107 0.11
108 0.13
109 0.14
110 0.13
111 0.13
112 0.12
113 0.1
114 0.1
115 0.09