Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FW30

Protein Details
Accession M5FW30   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-86GGEGKSKAQKKNEKRKEKKREKEPVASSPBasic
NLS Segment(s)
PositionSequence
49-80SGAGAGSGAGGEGKSKAQKKNEKRKEKKREKE
Subcellular Location(s) mito 12.5, mito_nucl 11.5, nucl 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Amino Acid Sequences MRKELRIRPGFTPQEDVGLFRSRRQQTDGRPSLPPGAVSRSVPGAGPRSGAGAGSGAGGEGKSKAQKKNEKRKEKKREKEPVASSPSSAVGGAVGVGEKKQEVVKDAWDEEDVRAETETRREQADAEVLKLAEELEKKAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.37
4 0.31
5 0.33
6 0.31
7 0.28
8 0.37
9 0.36
10 0.38
11 0.43
12 0.46
13 0.48
14 0.58
15 0.62
16 0.55
17 0.53
18 0.52
19 0.51
20 0.44
21 0.36
22 0.27
23 0.26
24 0.24
25 0.23
26 0.22
27 0.19
28 0.19
29 0.17
30 0.18
31 0.16
32 0.14
33 0.15
34 0.13
35 0.13
36 0.13
37 0.12
38 0.1
39 0.07
40 0.06
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.1
50 0.15
51 0.2
52 0.28
53 0.38
54 0.49
55 0.6
56 0.69
57 0.76
58 0.82
59 0.88
60 0.91
61 0.93
62 0.92
63 0.91
64 0.92
65 0.87
66 0.86
67 0.8
68 0.76
69 0.72
70 0.62
71 0.52
72 0.42
73 0.35
74 0.26
75 0.21
76 0.13
77 0.06
78 0.05
79 0.05
80 0.04
81 0.03
82 0.03
83 0.03
84 0.04
85 0.04
86 0.05
87 0.07
88 0.07
89 0.11
90 0.12
91 0.16
92 0.2
93 0.2
94 0.21
95 0.21
96 0.21
97 0.18
98 0.22
99 0.18
100 0.15
101 0.15
102 0.15
103 0.15
104 0.21
105 0.25
106 0.22
107 0.23
108 0.23
109 0.23
110 0.25
111 0.31
112 0.26
113 0.23
114 0.24
115 0.22
116 0.21
117 0.21
118 0.18
119 0.14
120 0.15
121 0.17