Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5GGT0

Protein Details
Accession M5GGT0    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-41RTTTAIEKKPKPSHRKGVKNEKSKFVHydrophilic
59-83MELLRNSKDKKARKLTKKRLGTLLRHydrophilic
NLS Segment(s)
PositionSequence
23-36KKPKPSHRKGVKNE
65-87SKDKKARKLTKKRLGTLLRSKRK
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAVTRTNLRFGANTGRTTTAIEKKPKPSHRKGVKNEKSKFVYSVVREVAGFAPYERRVMELLRNSKDKKARKLTKKRLGTLLRSKRKLEELLNVIAESRRAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.31
4 0.33
5 0.36
6 0.34
7 0.37
8 0.43
9 0.47
10 0.54
11 0.63
12 0.7
13 0.74
14 0.75
15 0.78
16 0.81
17 0.85
18 0.85
19 0.87
20 0.87
21 0.87
22 0.82
23 0.79
24 0.73
25 0.64
26 0.56
27 0.48
28 0.44
29 0.35
30 0.35
31 0.28
32 0.24
33 0.22
34 0.21
35 0.18
36 0.13
37 0.11
38 0.07
39 0.1
40 0.1
41 0.11
42 0.1
43 0.1
44 0.1
45 0.12
46 0.17
47 0.21
48 0.27
49 0.3
50 0.36
51 0.36
52 0.42
53 0.49
54 0.51
55 0.54
56 0.59
57 0.65
58 0.71
59 0.81
60 0.86
61 0.88
62 0.89
63 0.84
64 0.83
65 0.79
66 0.77
67 0.77
68 0.77
69 0.77
70 0.73
71 0.71
72 0.65
73 0.64
74 0.61
75 0.54
76 0.52
77 0.46
78 0.46
79 0.45
80 0.4
81 0.35
82 0.3