Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5G846

Protein Details
Accession M5G846    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
48-72DSEEKLKSTKKSKKRRHVADAVQVEHydrophilic
NLS Segment(s)
PositionSequence
54-63KSTKKSKKRR
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 10.333, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDYYITSSRKELFGNSEAAGSSLPADPTELAVFDDALKAQLDVPIVPDSEEKLKSTKKSKKRRHVADAVQVEPVFEFKLVSGSSQPQSISLQEPAALAGILNPHVYEDTTEEEDQRRQRVSGIAVDTSWLLKEASTNWASPKPHKQPVEVKVDVKGDTIPSLFVVERQRWPLKPNERSSVAAKANVQKIRVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.25
4 0.22
5 0.22
6 0.19
7 0.13
8 0.11
9 0.1
10 0.1
11 0.09
12 0.1
13 0.1
14 0.11
15 0.12
16 0.1
17 0.09
18 0.09
19 0.09
20 0.09
21 0.09
22 0.07
23 0.08
24 0.08
25 0.07
26 0.07
27 0.09
28 0.09
29 0.08
30 0.11
31 0.11
32 0.11
33 0.12
34 0.12
35 0.12
36 0.16
37 0.17
38 0.16
39 0.2
40 0.24
41 0.3
42 0.4
43 0.47
44 0.53
45 0.63
46 0.73
47 0.79
48 0.85
49 0.88
50 0.87
51 0.87
52 0.84
53 0.82
54 0.76
55 0.66
56 0.57
57 0.47
58 0.38
59 0.28
60 0.22
61 0.12
62 0.07
63 0.06
64 0.04
65 0.07
66 0.07
67 0.07
68 0.08
69 0.11
70 0.12
71 0.13
72 0.13
73 0.12
74 0.12
75 0.13
76 0.13
77 0.11
78 0.11
79 0.1
80 0.1
81 0.09
82 0.08
83 0.06
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.06
95 0.08
96 0.12
97 0.12
98 0.13
99 0.14
100 0.19
101 0.21
102 0.22
103 0.21
104 0.18
105 0.19
106 0.21
107 0.21
108 0.21
109 0.21
110 0.18
111 0.17
112 0.17
113 0.16
114 0.13
115 0.11
116 0.08
117 0.06
118 0.05
119 0.06
120 0.07
121 0.13
122 0.14
123 0.15
124 0.17
125 0.23
126 0.25
127 0.3
128 0.39
129 0.41
130 0.48
131 0.5
132 0.54
133 0.58
134 0.63
135 0.66
136 0.59
137 0.52
138 0.48
139 0.48
140 0.42
141 0.34
142 0.27
143 0.19
144 0.17
145 0.16
146 0.12
147 0.1
148 0.12
149 0.11
150 0.15
151 0.2
152 0.22
153 0.26
154 0.33
155 0.39
156 0.39
157 0.43
158 0.48
159 0.53
160 0.59
161 0.62
162 0.62
163 0.61
164 0.63
165 0.63
166 0.62
167 0.54
168 0.49
169 0.46
170 0.47
171 0.5
172 0.5