Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5G7U7

Protein Details
Accession M5G7U7    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-43LTGFRKRKMERVKGKVERAKEBasic
147-188QPLEKKKTAMAKPKERKFRYETKAARRSAKDKERSRRREKGDBasic
NLS Segment(s)
PositionSequence
27-63RKRKMERVKGKVERAKERERVERLRDRAEKRKDIRER
147-188QPLEKKKTAMAKPKERKFRYETKAARRSAKDKERSRRREKGD
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences KKRQKKAQLQEVVFDEEARREYLTGFRKRKMERVKGKVERAKERERVERLRDRAEKRKDIRERALENARRVESALGAVDLPGSETLDDTGAEGGREEEEEYEGEEQFATVTVVEDFDPSVEMHGLVSSTVPKDAVDEEDARPAPKVQPLEKKKTAMAKPKERKFRYETKAARRSAKDKERSRRREKGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.33
3 0.25
4 0.25
5 0.21
6 0.18
7 0.13
8 0.14
9 0.21
10 0.29
11 0.38
12 0.42
13 0.46
14 0.54
15 0.57
16 0.65
17 0.68
18 0.7
19 0.7
20 0.73
21 0.79
22 0.79
23 0.86
24 0.82
25 0.79
26 0.78
27 0.75
28 0.74
29 0.71
30 0.69
31 0.68
32 0.69
33 0.69
34 0.67
35 0.69
36 0.65
37 0.66
38 0.69
39 0.67
40 0.7
41 0.71
42 0.72
43 0.68
44 0.74
45 0.73
46 0.72
47 0.73
48 0.72
49 0.66
50 0.64
51 0.68
52 0.63
53 0.57
54 0.55
55 0.47
56 0.39
57 0.36
58 0.29
59 0.2
60 0.15
61 0.12
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.07
89 0.07
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.04
96 0.03
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.05
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.04
113 0.05
114 0.06
115 0.06
116 0.06
117 0.07
118 0.06
119 0.08
120 0.09
121 0.1
122 0.12
123 0.14
124 0.15
125 0.2
126 0.21
127 0.2
128 0.2
129 0.19
130 0.18
131 0.2
132 0.25
133 0.26
134 0.37
135 0.44
136 0.53
137 0.57
138 0.58
139 0.58
140 0.62
141 0.64
142 0.63
143 0.65
144 0.67
145 0.72
146 0.79
147 0.85
148 0.79
149 0.79
150 0.75
151 0.76
152 0.72
153 0.72
154 0.72
155 0.72
156 0.78
157 0.76
158 0.77
159 0.74
160 0.73
161 0.73
162 0.74
163 0.74
164 0.75
165 0.81
166 0.83
167 0.87
168 0.9