Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G2Q0

Protein Details
Accession M5G2Q0   
Localization Confidence High
Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAHKRPKRSVREQEQKQRGFDBasic
43-66QSIRAEYKEKKRKREEEPTGQEKTBasic
NLS Segment(s)
PositionSequence
50-133KEKKRKREEEPTGQEKTSKKRKTEAEKEKEELKLRPGERLEDFNRRVDRALKPRIKASKASKAKAIISEKEAAPESAPPPTKKE
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MAHKRPKRSVREQEQKQRGFDHAPKTAEKDDAPRGAMRVLNAQSIRAEYKEKKRKREEEPTGQEKTSKKRKTEAEKEKEELKLRPGERLEDFNRRVDRALKPRIKASKASKAKAIISEKEAAPESAPPPTKKERKTDFDSLPLSRRVNDIAQAPPSLTRLPQNAAKKGEGREGKEGVLSLATRAALEEERARVVERYRLLKESKIKEKEMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.87
3 0.79
4 0.71
5 0.64
6 0.61
7 0.57
8 0.54
9 0.5
10 0.48
11 0.48
12 0.5
13 0.49
14 0.44
15 0.39
16 0.37
17 0.37
18 0.36
19 0.36
20 0.32
21 0.3
22 0.29
23 0.29
24 0.24
25 0.24
26 0.22
27 0.26
28 0.25
29 0.25
30 0.23
31 0.24
32 0.24
33 0.19
34 0.24
35 0.26
36 0.37
37 0.47
38 0.53
39 0.61
40 0.7
41 0.77
42 0.8
43 0.84
44 0.82
45 0.83
46 0.85
47 0.81
48 0.75
49 0.66
50 0.62
51 0.55
52 0.54
53 0.54
54 0.51
55 0.47
56 0.51
57 0.6
58 0.66
59 0.72
60 0.74
61 0.73
62 0.72
63 0.71
64 0.68
65 0.64
66 0.56
67 0.47
68 0.4
69 0.38
70 0.33
71 0.36
72 0.33
73 0.31
74 0.3
75 0.34
76 0.34
77 0.35
78 0.36
79 0.36
80 0.37
81 0.34
82 0.34
83 0.32
84 0.35
85 0.35
86 0.43
87 0.43
88 0.42
89 0.48
90 0.53
91 0.51
92 0.51
93 0.49
94 0.5
95 0.51
96 0.51
97 0.48
98 0.44
99 0.44
100 0.43
101 0.4
102 0.31
103 0.27
104 0.29
105 0.25
106 0.25
107 0.24
108 0.17
109 0.14
110 0.14
111 0.12
112 0.15
113 0.18
114 0.17
115 0.22
116 0.31
117 0.38
118 0.41
119 0.5
120 0.53
121 0.57
122 0.63
123 0.66
124 0.6
125 0.59
126 0.58
127 0.51
128 0.46
129 0.44
130 0.37
131 0.3
132 0.29
133 0.25
134 0.22
135 0.22
136 0.21
137 0.2
138 0.21
139 0.21
140 0.2
141 0.18
142 0.19
143 0.17
144 0.15
145 0.16
146 0.16
147 0.2
148 0.27
149 0.33
150 0.37
151 0.4
152 0.42
153 0.43
154 0.42
155 0.48
156 0.46
157 0.43
158 0.43
159 0.41
160 0.38
161 0.35
162 0.32
163 0.24
164 0.21
165 0.16
166 0.11
167 0.11
168 0.1
169 0.09
170 0.09
171 0.11
172 0.1
173 0.13
174 0.15
175 0.16
176 0.17
177 0.18
178 0.2
179 0.2
180 0.22
181 0.26
182 0.28
183 0.33
184 0.36
185 0.41
186 0.42
187 0.47
188 0.54
189 0.57
190 0.62
191 0.61