Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G0Y2

Protein Details
Accession M5G0Y2    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-56QQPPSHQPHPQPQPRPHPQQPQPPQPQQQQHydrophilic
213-235HQTTAQAQKQKQKQMQKQKEMRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSSQEYAPPPSLAHVFSGQYALPAHLQQPPSHQPHPQPQPRPHPQQPQPPQPQQQQTQGYSLVPFHPQPTQAQPTSPRRPLPQPTPAPQAQAQAPWPCAQYPAPVPVSLYPSTPAPAAAPTFAHPQQVQQVPPPPQIASPTASYPRGYQGILTGSRSLPLGGEGERERERDRNAVRERDRDGRDIDRDGWERDRQERDRGGHKGSGRTRSVIHQTTAQAQKQKQKQMQKQKEMRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.2
5 0.17
6 0.16
7 0.16
8 0.14
9 0.13
10 0.14
11 0.15
12 0.18
13 0.2
14 0.2
15 0.27
16 0.34
17 0.39
18 0.41
19 0.44
20 0.46
21 0.54
22 0.64
23 0.66
24 0.67
25 0.68
26 0.76
27 0.81
28 0.84
29 0.82
30 0.82
31 0.81
32 0.83
33 0.83
34 0.83
35 0.83
36 0.82
37 0.81
38 0.79
39 0.78
40 0.72
41 0.71
42 0.67
43 0.59
44 0.53
45 0.47
46 0.39
47 0.32
48 0.28
49 0.21
50 0.17
51 0.16
52 0.15
53 0.16
54 0.17
55 0.19
56 0.24
57 0.29
58 0.26
59 0.29
60 0.36
61 0.43
62 0.5
63 0.52
64 0.48
65 0.47
66 0.53
67 0.57
68 0.56
69 0.56
70 0.54
71 0.54
72 0.57
73 0.54
74 0.5
75 0.44
76 0.4
77 0.31
78 0.27
79 0.25
80 0.21
81 0.21
82 0.19
83 0.18
84 0.16
85 0.17
86 0.15
87 0.14
88 0.14
89 0.17
90 0.17
91 0.16
92 0.17
93 0.16
94 0.2
95 0.18
96 0.17
97 0.13
98 0.12
99 0.13
100 0.12
101 0.11
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.12
109 0.12
110 0.14
111 0.13
112 0.14
113 0.19
114 0.21
115 0.2
116 0.19
117 0.25
118 0.26
119 0.28
120 0.28
121 0.23
122 0.21
123 0.22
124 0.21
125 0.17
126 0.16
127 0.16
128 0.18
129 0.19
130 0.19
131 0.17
132 0.19
133 0.18
134 0.16
135 0.14
136 0.13
137 0.16
138 0.16
139 0.17
140 0.16
141 0.14
142 0.15
143 0.15
144 0.13
145 0.09
146 0.08
147 0.08
148 0.07
149 0.11
150 0.11
151 0.16
152 0.17
153 0.19
154 0.21
155 0.24
156 0.26
157 0.31
158 0.33
159 0.39
160 0.44
161 0.52
162 0.54
163 0.56
164 0.59
165 0.6
166 0.59
167 0.53
168 0.5
169 0.47
170 0.45
171 0.43
172 0.4
173 0.38
174 0.38
175 0.38
176 0.39
177 0.37
178 0.37
179 0.4
180 0.47
181 0.44
182 0.49
183 0.53
184 0.53
185 0.56
186 0.57
187 0.55
188 0.52
189 0.53
190 0.54
191 0.54
192 0.57
193 0.51
194 0.49
195 0.46
196 0.47
197 0.52
198 0.47
199 0.42
200 0.39
201 0.39
202 0.45
203 0.51
204 0.49
205 0.48
206 0.49
207 0.57
208 0.6
209 0.68
210 0.68
211 0.71
212 0.77
213 0.81
214 0.86
215 0.88