Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5FPH5

Protein Details
Accession M5FPH5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-46SAATNKRAPHARKKRKRTKDPEANNLSVHydrophilic
NLS Segment(s)
PositionSequence
24-37KRAPHARKKRKRTK
Subcellular Location(s) cyto 13.5, nucl 12, cyto_mito 7.5
Family & Domain DBs
Amino Acid Sequences MAEGSRLGNLLARCVDDASAATNKRAPHARKKRKRTKDPEANNLSVHSAGENIPLLREDEDNAVLKEHQEGEIEEVVAVVERLVADAGSGAFSQQKDWYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.12
4 0.12
5 0.12
6 0.17
7 0.17
8 0.17
9 0.2
10 0.2
11 0.24
12 0.32
13 0.34
14 0.4
15 0.51
16 0.61
17 0.69
18 0.8
19 0.86
20 0.89
21 0.94
22 0.93
23 0.93
24 0.92
25 0.9
26 0.89
27 0.84
28 0.75
29 0.64
30 0.55
31 0.44
32 0.33
33 0.25
34 0.14
35 0.08
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.11
49 0.11
50 0.11
51 0.1
52 0.11
53 0.11
54 0.1
55 0.1
56 0.09
57 0.1
58 0.12
59 0.13
60 0.13
61 0.11
62 0.1
63 0.09
64 0.08
65 0.08
66 0.04
67 0.04
68 0.03
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.06
76 0.06
77 0.06
78 0.09
79 0.1
80 0.12