Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5FRR4

Protein Details
Accession M5FRR4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-93LPERRMIQKKKQGEKRKEEEKETPKRKESDREKERQKEKEKGERYBasic
NLS Segment(s)
PositionSequence
52-90RRMIQKKKQGEKRKEEEKETPKRKESDREKERQKEKEKG
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGITSSYRSDHVDRDLYLSCLPSPLTHRCLQGISGRRLTLRRCLHSPPLPERRMIQKKKQGEKRKEEEKETPKRKESDREKERQKEKEKGERYPTILPNFLNWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.28
4 0.26
5 0.24
6 0.19
7 0.16
8 0.16
9 0.14
10 0.18
11 0.21
12 0.25
13 0.27
14 0.28
15 0.29
16 0.29
17 0.29
18 0.31
19 0.33
20 0.33
21 0.33
22 0.32
23 0.33
24 0.35
25 0.35
26 0.38
27 0.36
28 0.35
29 0.36
30 0.39
31 0.44
32 0.46
33 0.5
34 0.49
35 0.52
36 0.49
37 0.46
38 0.44
39 0.47
40 0.53
41 0.53
42 0.53
43 0.52
44 0.61
45 0.69
46 0.77
47 0.78
48 0.77
49 0.81
50 0.8
51 0.82
52 0.78
53 0.74
54 0.74
55 0.73
56 0.74
57 0.74
58 0.72
59 0.68
60 0.68
61 0.67
62 0.68
63 0.68
64 0.69
65 0.69
66 0.72
67 0.77
68 0.81
69 0.85
70 0.85
71 0.83
72 0.81
73 0.81
74 0.81
75 0.78
76 0.77
77 0.77
78 0.73
79 0.7
80 0.69
81 0.67
82 0.61
83 0.58
84 0.5