Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5GAE9

Protein Details
Accession M5GAE9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-46AASIPIIKKRTKRFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-53KKRTKRFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPKI
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASIPIIKKRTKRFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGLKKMLVHNVREVDILLMHNKTFAVEVAHGVSSKNRVGIIDRAKALGLKVTNASARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.86
3 0.92
4 0.95
5 0.94
6 0.94
7 0.93
8 0.91
9 0.89
10 0.82
11 0.73
12 0.7
13 0.68
14 0.67
15 0.68
16 0.69
17 0.69
18 0.67
19 0.67
20 0.67
21 0.69
22 0.69
23 0.69
24 0.69
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.64
34 0.64
35 0.63
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.47
49 0.47
50 0.45
51 0.47
52 0.45
53 0.53
54 0.55
55 0.51
56 0.47
57 0.39
58 0.39
59 0.37
60 0.33
61 0.24
62 0.25
63 0.26
64 0.27
65 0.27
66 0.23
67 0.16
68 0.13
69 0.12
70 0.1
71 0.09
72 0.08
73 0.09
74 0.08
75 0.08
76 0.08
77 0.07
78 0.08
79 0.08
80 0.09
81 0.1
82 0.11
83 0.11
84 0.11
85 0.12
86 0.13
87 0.14
88 0.14
89 0.13
90 0.13
91 0.16
92 0.24
93 0.29
94 0.31
95 0.31
96 0.31
97 0.31
98 0.31
99 0.28
100 0.25
101 0.19
102 0.16
103 0.17
104 0.19
105 0.21
106 0.23
107 0.25
108 0.23