Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G6L4

Protein Details
Accession M5G6L4   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-131GNEYQPSQRKRKRKFGFLQRLKDKNGRKTLARRRAKGRRFLSHBasic
NLS Segment(s)
PositionSequence
97-128RKRKRKFGFLQRLKDKNGRKTLARRRAKGRRF
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRQLLNRAIRAAGRTAKRLAAPTTTAPAYISPVARPTSSLTLPMPIRSLTPFASPRSPLSAFGAPLPRPTLPSPLASVLPLLQARFLGNEYQPSQRKRKRKFGFLQRLKDKNGRKTLARRRAKGRRFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.35
4 0.36
5 0.36
6 0.38
7 0.35
8 0.3
9 0.3
10 0.28
11 0.3
12 0.27
13 0.25
14 0.22
15 0.2
16 0.19
17 0.18
18 0.17
19 0.13
20 0.16
21 0.18
22 0.17
23 0.18
24 0.18
25 0.2
26 0.19
27 0.21
28 0.18
29 0.22
30 0.22
31 0.22
32 0.2
33 0.15
34 0.16
35 0.15
36 0.16
37 0.12
38 0.16
39 0.18
40 0.19
41 0.22
42 0.22
43 0.22
44 0.25
45 0.24
46 0.21
47 0.23
48 0.22
49 0.19
50 0.2
51 0.23
52 0.18
53 0.18
54 0.19
55 0.15
56 0.16
57 0.17
58 0.19
59 0.17
60 0.18
61 0.18
62 0.18
63 0.18
64 0.15
65 0.15
66 0.1
67 0.12
68 0.11
69 0.09
70 0.08
71 0.08
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.14
78 0.16
79 0.23
80 0.3
81 0.34
82 0.44
83 0.5
84 0.6
85 0.65
86 0.73
87 0.74
88 0.78
89 0.83
90 0.84
91 0.88
92 0.87
93 0.89
94 0.88
95 0.85
96 0.8
97 0.79
98 0.76
99 0.74
100 0.74
101 0.68
102 0.67
103 0.72
104 0.77
105 0.79
106 0.81
107 0.79
108 0.8
109 0.86
110 0.86
111 0.86