Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G6J3

Protein Details
Accession M5G6J3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23EETSSPKRRKRSLNKRGYASPDTHydrophilic
NLS Segment(s)
PositionSequence
7-12KRRKRS
Subcellular Location(s) mito 21, cyto 4.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015637  MUG/TDG  
IPR005122  Uracil-DNA_glycosylase-like  
IPR036895  Uracil-DNA_glycosylase-like_sf  
Gene Ontology GO:0000700  F:mismatch base pair DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF03167  UDG  
CDD cd10028  UDG-F2_TDG_MUG  
Amino Acid Sequences EETSSPKRRKRSLNKRGYASPDTYAHLGLVHDYLGFGLDGSPGVMSAATGHHFANPTNHFWRALHQGGLVSRFVPASEDHTLPEKYNLGITNLVERPSIEAAKLSAKEMTAGVPAFLAKVKKWRPRIVCFVGKGIWLAVKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.84
4 0.81
5 0.74
6 0.66
7 0.59
8 0.5
9 0.44
10 0.39
11 0.32
12 0.24
13 0.2
14 0.16
15 0.12
16 0.11
17 0.08
18 0.07
19 0.06
20 0.06
21 0.06
22 0.05
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.03
33 0.04
34 0.05
35 0.06
36 0.07
37 0.07
38 0.08
39 0.09
40 0.1
41 0.16
42 0.17
43 0.2
44 0.22
45 0.23
46 0.23
47 0.22
48 0.25
49 0.25
50 0.24
51 0.2
52 0.18
53 0.18
54 0.18
55 0.19
56 0.16
57 0.09
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.1
64 0.13
65 0.13
66 0.13
67 0.17
68 0.18
69 0.17
70 0.18
71 0.14
72 0.12
73 0.14
74 0.14
75 0.12
76 0.13
77 0.13
78 0.17
79 0.17
80 0.18
81 0.16
82 0.15
83 0.16
84 0.17
85 0.17
86 0.11
87 0.11
88 0.11
89 0.16
90 0.17
91 0.15
92 0.14
93 0.13
94 0.14
95 0.14
96 0.14
97 0.11
98 0.11
99 0.1
100 0.09
101 0.09
102 0.09
103 0.11
104 0.12
105 0.11
106 0.21
107 0.3
108 0.39
109 0.48
110 0.57
111 0.63
112 0.69
113 0.77
114 0.76
115 0.75
116 0.69
117 0.65
118 0.57
119 0.49
120 0.42
121 0.33