Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G0J7

Protein Details
Accession M5G0J7   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
119-145APAARVRRPSPVKRRSRKRAASPIPVEHydrophilic
NLS Segment(s)
PositionSequence
120-138PAARVRRPSPVKRRSRKRA
Subcellular Location(s) nucl 15.5, cyto_nucl 9.833, mito 7.5, cyto_mito 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013924  RNase_H2_suC  
Gene Ontology GO:0032299  C:ribonuclease H2 complex  
GO:0006401  P:RNA catabolic process  
Pfam View protein in Pfam  
PF08615  RNase_H2_suC  
CDD cd09271  RNase_H2-C  
Amino Acid Sequences MSTIHFLPPRGQPTNPTLHLMPFHIEHNGPCPLSTYFLVRPASDLPSASASTFASTSAPTSVSPSTSLPDKTETQSPGNPSLKNRFTSSFRGRALKGVQVPLPEGYTGVLLRSSAPAPAPAARVRRPSPVKRRSRKRAASPIPVETDGDGDAGERQAEDQREKKDLRIEGCFEGFVLWNADVDVDEEDEYLRTLGEWQRLAALIHDTHLGGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.44
4 0.38
5 0.36
6 0.37
7 0.34
8 0.31
9 0.23
10 0.22
11 0.21
12 0.21
13 0.19
14 0.21
15 0.24
16 0.21
17 0.2
18 0.21
19 0.19
20 0.22
21 0.22
22 0.23
23 0.21
24 0.27
25 0.28
26 0.25
27 0.26
28 0.25
29 0.27
30 0.22
31 0.21
32 0.16
33 0.18
34 0.18
35 0.16
36 0.15
37 0.12
38 0.12
39 0.12
40 0.1
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.08
47 0.11
48 0.12
49 0.12
50 0.13
51 0.13
52 0.14
53 0.16
54 0.17
55 0.15
56 0.19
57 0.2
58 0.21
59 0.25
60 0.27
61 0.27
62 0.29
63 0.3
64 0.35
65 0.36
66 0.35
67 0.34
68 0.39
69 0.4
70 0.39
71 0.38
72 0.34
73 0.34
74 0.41
75 0.44
76 0.42
77 0.41
78 0.42
79 0.4
80 0.4
81 0.38
82 0.33
83 0.29
84 0.24
85 0.23
86 0.2
87 0.21
88 0.17
89 0.16
90 0.11
91 0.09
92 0.07
93 0.07
94 0.06
95 0.05
96 0.05
97 0.04
98 0.05
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.08
105 0.09
106 0.11
107 0.14
108 0.18
109 0.21
110 0.27
111 0.28
112 0.36
113 0.42
114 0.49
115 0.57
116 0.63
117 0.7
118 0.75
119 0.84
120 0.85
121 0.89
122 0.88
123 0.87
124 0.88
125 0.85
126 0.84
127 0.77
128 0.71
129 0.63
130 0.55
131 0.46
132 0.35
133 0.28
134 0.18
135 0.14
136 0.1
137 0.07
138 0.06
139 0.06
140 0.06
141 0.05
142 0.06
143 0.1
144 0.13
145 0.18
146 0.23
147 0.26
148 0.33
149 0.34
150 0.36
151 0.39
152 0.41
153 0.4
154 0.4
155 0.41
156 0.37
157 0.37
158 0.33
159 0.26
160 0.23
161 0.19
162 0.15
163 0.13
164 0.1
165 0.09
166 0.09
167 0.09
168 0.08
169 0.09
170 0.09
171 0.07
172 0.07
173 0.07
174 0.08
175 0.08
176 0.09
177 0.08
178 0.07
179 0.06
180 0.1
181 0.15
182 0.2
183 0.2
184 0.2
185 0.22
186 0.23
187 0.24
188 0.21
189 0.21
190 0.16
191 0.16
192 0.17
193 0.15