Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5FRS7

Protein Details
Accession M5FRS7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-40GGGGKAAKKKKWSKGKVKDKAQHMVTBasic
NLS Segment(s)
PositionSequence
10-34AAASSGGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) cyto 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPVTVAKAKAAASSGGGGKAAKKKKWSKGKVKDKAQHMVTLDKPTYDRIMKEVPTFKFISQSILIERLKVNGSLARVAIAHLEKDGLIKRIVHHHGQLIYTRSVGGKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.13
5 0.16
6 0.24
7 0.31
8 0.32
9 0.41
10 0.5
11 0.59
12 0.7
13 0.75
14 0.78
15 0.82
16 0.89
17 0.89
18 0.91
19 0.88
20 0.83
21 0.81
22 0.71
23 0.64
24 0.54
25 0.49
26 0.41
27 0.39
28 0.33
29 0.25
30 0.24
31 0.22
32 0.23
33 0.2
34 0.18
35 0.16
36 0.19
37 0.2
38 0.23
39 0.28
40 0.25
41 0.27
42 0.28
43 0.24
44 0.24
45 0.23
46 0.23
47 0.17
48 0.18
49 0.15
50 0.19
51 0.19
52 0.17
53 0.17
54 0.15
55 0.15
56 0.15
57 0.14
58 0.11
59 0.12
60 0.12
61 0.12
62 0.11
63 0.1
64 0.1
65 0.13
66 0.11
67 0.1
68 0.09
69 0.09
70 0.09
71 0.12
72 0.14
73 0.13
74 0.14
75 0.15
76 0.17
77 0.25
78 0.3
79 0.31
80 0.31
81 0.34
82 0.35
83 0.36
84 0.39
85 0.34
86 0.31
87 0.27
88 0.26
89 0.21