Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5G1Z0

Protein Details
Accession M5G1Z0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-94YLKYLTKKFLKKNQLRDWIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 11, cyto 9, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAKAAKPVVSKHKFVIDYSKPAGDGVFDGGLYEKFLRDRIKVEGKPGQLGESIKISKEGTNKLAVQASIPFSKRYLKYLTKKFLKKNQLRDWIRVVATEKDRYELRFYNIAEDAEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.43
4 0.45
5 0.45
6 0.43
7 0.35
8 0.33
9 0.31
10 0.22
11 0.17
12 0.12
13 0.1
14 0.08
15 0.08
16 0.09
17 0.09
18 0.1
19 0.09
20 0.08
21 0.08
22 0.12
23 0.15
24 0.16
25 0.18
26 0.23
27 0.32
28 0.32
29 0.38
30 0.4
31 0.38
32 0.39
33 0.36
34 0.31
35 0.24
36 0.23
37 0.19
38 0.17
39 0.16
40 0.13
41 0.15
42 0.14
43 0.14
44 0.17
45 0.19
46 0.17
47 0.19
48 0.19
49 0.19
50 0.2
51 0.17
52 0.14
53 0.14
54 0.15
55 0.15
56 0.15
57 0.15
58 0.15
59 0.21
60 0.22
61 0.23
62 0.28
63 0.34
64 0.43
65 0.51
66 0.6
67 0.62
68 0.69
69 0.74
70 0.76
71 0.78
72 0.77
73 0.79
74 0.79
75 0.81
76 0.77
77 0.73
78 0.7
79 0.64
80 0.56
81 0.48
82 0.41
83 0.38
84 0.39
85 0.4
86 0.35
87 0.34
88 0.35
89 0.35
90 0.38
91 0.35
92 0.35
93 0.36
94 0.36
95 0.37
96 0.38
97 0.36
98 0.3