Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M5G0N1

Protein Details
Accession M5G0N1   
Localization Confidence High
Confidence Score 21.6
NoLS Segment(s)
PositionSequenceProtein Nature
41-67LGSYSQERRRERKSKEGDNQNQREKEKHydrophilic
80-110TPTPLMPRSENKEDKKRKMRHNRTRSAVNTPHydrophilic
145-173PSPTQTQTQSQRRKGSQRRKTARALHTPAHydrophilic
562-584RGKGKDKLPKEVRETKRREKAEEBasic
594-630AKEAKELKDKEPKDKEQREREPREPREKEQRGKKIVYBasic
NLS Segment(s)
PositionSequence
52-52R
93-100DKKRKMRH
559-627DRARGKGKDKLPKEVRETKRREKAEERALAKETKAAKEAKELKDKEPKDKEQREREPREPREKEQRGKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MSLSPSPSPARTPAPAPAPAHAPMQVHAHKRPGVIMLSKPLGSYSQERRRERKSKEGDNQNQREKEKDRESKYPVSMPTTPTPLMPRSENKEDKKRKMRHNRTRSAVNTPIPTSTPTPAAAAGTTASPDRPTSPSSPTRPPRTPPSPTQTQTQSQRRKGSQRRKTARALHTPAIMLGPSASAPQLEDVFSSSPSLPLAAAAQVQDATTTTAAAATARSALAQSLRNSAITPPMHISDIVPITPGSAPASASLLSTPAPISPPAPVPVPTSGANGANQKKRNLRNSMINIPLSANSPAISTPVKASTGPGKTGSLRIPRTQSHPFYQMDLSLSPSPSLSRSVPSQSQSLRMYSGSSPVLSTPVRAVPPAAVPATVPGPRTGPGSGSGTGTGARPPPNSETKHKPTLSLALASHVPLPVPVQMQAASLPSTPLPRLDNATSGSGMGSGRGSGPGMGMGMGSGSGGYWNHARGITFPSAAGGVFPPIPMPVPGSISMQELEESFASYSYSSSSMEDSDLSVDVEGMGTDMELEEQQEEREEIVFFGQKDMDRLDRVDRKLTDRARGKGKDKLPKEVRETKRREKAEERALAKETKAAKEAKELKDKEPKDKEQREREPREPREKEQRGKKIVYAGPQFYNSPAPDALPPPTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.43
4 0.41
5 0.4
6 0.38
7 0.37
8 0.34
9 0.29
10 0.25
11 0.31
12 0.35
13 0.38
14 0.4
15 0.45
16 0.44
17 0.44
18 0.44
19 0.39
20 0.38
21 0.36
22 0.36
23 0.36
24 0.36
25 0.35
26 0.33
27 0.3
28 0.27
29 0.26
30 0.3
31 0.34
32 0.41
33 0.51
34 0.58
35 0.65
36 0.73
37 0.79
38 0.79
39 0.8
40 0.8
41 0.81
42 0.83
43 0.87
44 0.87
45 0.88
46 0.9
47 0.89
48 0.86
49 0.77
50 0.75
51 0.68
52 0.68
53 0.67
54 0.67
55 0.64
56 0.66
57 0.71
58 0.72
59 0.72
60 0.68
61 0.61
62 0.58
63 0.55
64 0.51
65 0.49
66 0.45
67 0.41
68 0.37
69 0.38
70 0.35
71 0.35
72 0.35
73 0.37
74 0.4
75 0.5
76 0.57
77 0.61
78 0.69
79 0.75
80 0.81
81 0.84
82 0.86
83 0.87
84 0.89
85 0.92
86 0.92
87 0.93
88 0.92
89 0.88
90 0.88
91 0.81
92 0.78
93 0.74
94 0.68
95 0.61
96 0.53
97 0.48
98 0.39
99 0.39
100 0.33
101 0.27
102 0.24
103 0.21
104 0.2
105 0.19
106 0.18
107 0.15
108 0.13
109 0.11
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.1
116 0.13
117 0.15
118 0.19
119 0.21
120 0.28
121 0.36
122 0.4
123 0.5
124 0.55
125 0.62
126 0.63
127 0.65
128 0.68
129 0.68
130 0.69
131 0.67
132 0.66
133 0.67
134 0.63
135 0.64
136 0.6
137 0.6
138 0.63
139 0.65
140 0.67
141 0.65
142 0.71
143 0.72
144 0.77
145 0.8
146 0.81
147 0.8
148 0.82
149 0.83
150 0.82
151 0.84
152 0.83
153 0.81
154 0.8
155 0.77
156 0.69
157 0.62
158 0.55
159 0.46
160 0.37
161 0.28
162 0.17
163 0.11
164 0.08
165 0.06
166 0.06
167 0.06
168 0.05
169 0.05
170 0.07
171 0.07
172 0.07
173 0.07
174 0.09
175 0.1
176 0.1
177 0.12
178 0.1
179 0.1
180 0.1
181 0.1
182 0.08
183 0.07
184 0.08
185 0.06
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.06
193 0.07
194 0.06
195 0.06
196 0.05
197 0.05
198 0.06
199 0.06
200 0.05
201 0.04
202 0.05
203 0.05
204 0.05
205 0.05
206 0.06
207 0.08
208 0.12
209 0.13
210 0.16
211 0.17
212 0.17
213 0.18
214 0.18
215 0.22
216 0.18
217 0.19
218 0.17
219 0.17
220 0.18
221 0.17
222 0.17
223 0.14
224 0.14
225 0.13
226 0.11
227 0.1
228 0.11
229 0.1
230 0.11
231 0.08
232 0.07
233 0.08
234 0.08
235 0.09
236 0.08
237 0.08
238 0.07
239 0.07
240 0.06
241 0.07
242 0.06
243 0.06
244 0.07
245 0.07
246 0.07
247 0.08
248 0.1
249 0.11
250 0.12
251 0.12
252 0.14
253 0.15
254 0.17
255 0.16
256 0.16
257 0.16
258 0.16
259 0.17
260 0.21
261 0.25
262 0.29
263 0.32
264 0.35
265 0.41
266 0.48
267 0.53
268 0.54
269 0.52
270 0.55
271 0.58
272 0.59
273 0.55
274 0.48
275 0.41
276 0.34
277 0.31
278 0.23
279 0.18
280 0.12
281 0.08
282 0.08
283 0.08
284 0.09
285 0.09
286 0.08
287 0.08
288 0.09
289 0.1
290 0.09
291 0.11
292 0.15
293 0.17
294 0.18
295 0.18
296 0.18
297 0.18
298 0.2
299 0.24
300 0.24
301 0.25
302 0.27
303 0.29
304 0.3
305 0.35
306 0.39
307 0.37
308 0.34
309 0.36
310 0.34
311 0.32
312 0.31
313 0.26
314 0.2
315 0.17
316 0.17
317 0.14
318 0.13
319 0.11
320 0.11
321 0.11
322 0.1
323 0.13
324 0.1
325 0.1
326 0.12
327 0.16
328 0.18
329 0.2
330 0.22
331 0.2
332 0.25
333 0.25
334 0.23
335 0.21
336 0.18
337 0.19
338 0.15
339 0.17
340 0.13
341 0.12
342 0.11
343 0.1
344 0.13
345 0.11
346 0.11
347 0.1
348 0.12
349 0.12
350 0.12
351 0.12
352 0.1
353 0.11
354 0.12
355 0.11
356 0.08
357 0.08
358 0.09
359 0.11
360 0.11
361 0.11
362 0.1
363 0.11
364 0.11
365 0.13
366 0.13
367 0.11
368 0.12
369 0.14
370 0.14
371 0.14
372 0.13
373 0.12
374 0.12
375 0.12
376 0.11
377 0.11
378 0.12
379 0.13
380 0.15
381 0.19
382 0.26
383 0.3
384 0.35
385 0.41
386 0.46
387 0.54
388 0.52
389 0.49
390 0.43
391 0.45
392 0.4
393 0.34
394 0.28
395 0.21
396 0.21
397 0.2
398 0.19
399 0.13
400 0.11
401 0.08
402 0.08
403 0.08
404 0.09
405 0.09
406 0.09
407 0.1
408 0.1
409 0.1
410 0.11
411 0.1
412 0.09
413 0.09
414 0.09
415 0.1
416 0.1
417 0.12
418 0.12
419 0.13
420 0.17
421 0.17
422 0.19
423 0.19
424 0.21
425 0.18
426 0.17
427 0.15
428 0.12
429 0.11
430 0.09
431 0.07
432 0.06
433 0.06
434 0.06
435 0.07
436 0.05
437 0.06
438 0.05
439 0.05
440 0.05
441 0.04
442 0.04
443 0.03
444 0.03
445 0.03
446 0.02
447 0.02
448 0.03
449 0.04
450 0.05
451 0.07
452 0.08
453 0.09
454 0.1
455 0.11
456 0.11
457 0.17
458 0.17
459 0.16
460 0.16
461 0.15
462 0.14
463 0.14
464 0.13
465 0.08
466 0.07
467 0.07
468 0.07
469 0.07
470 0.07
471 0.08
472 0.08
473 0.09
474 0.09
475 0.11
476 0.13
477 0.14
478 0.15
479 0.16
480 0.15
481 0.14
482 0.13
483 0.11
484 0.11
485 0.09
486 0.1
487 0.08
488 0.08
489 0.08
490 0.08
491 0.08
492 0.08
493 0.09
494 0.09
495 0.09
496 0.1
497 0.11
498 0.11
499 0.11
500 0.1
501 0.1
502 0.1
503 0.09
504 0.08
505 0.07
506 0.06
507 0.06
508 0.05
509 0.04
510 0.04
511 0.03
512 0.03
513 0.03
514 0.04
515 0.04
516 0.05
517 0.06
518 0.07
519 0.07
520 0.08
521 0.09
522 0.09
523 0.1
524 0.1
525 0.09
526 0.11
527 0.14
528 0.13
529 0.15
530 0.17
531 0.16
532 0.18
533 0.2
534 0.21
535 0.2
536 0.22
537 0.29
538 0.34
539 0.37
540 0.43
541 0.43
542 0.45
543 0.52
544 0.55
545 0.55
546 0.55
547 0.59
548 0.61
549 0.66
550 0.65
551 0.65
552 0.7
553 0.7
554 0.66
555 0.7
556 0.69
557 0.7
558 0.74
559 0.75
560 0.77
561 0.77
562 0.82
563 0.82
564 0.83
565 0.8
566 0.8
567 0.77
568 0.77
569 0.77
570 0.77
571 0.7
572 0.65
573 0.64
574 0.58
575 0.5
576 0.46
577 0.41
578 0.36
579 0.37
580 0.35
581 0.33
582 0.41
583 0.5
584 0.52
585 0.57
586 0.57
587 0.6
588 0.67
589 0.69
590 0.7
591 0.7
592 0.72
593 0.73
594 0.8
595 0.83
596 0.83
597 0.9
598 0.91
599 0.9
600 0.89
601 0.89
602 0.88
603 0.89
604 0.85
605 0.83
606 0.83
607 0.84
608 0.85
609 0.85
610 0.85
611 0.82
612 0.79
613 0.75
614 0.73
615 0.67
616 0.67
617 0.64
618 0.58
619 0.54
620 0.52
621 0.49
622 0.42
623 0.44
624 0.36
625 0.31
626 0.27
627 0.25
628 0.26
629 0.28