Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M5GFX5

Protein Details
Accession M5GFX5    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
329-357RDQSRERERDGGRKRRRSPSYSPVRRDSTBasic
NLS Segment(s)
PositionSequence
206-250GRGGPGAAVGRGVGRGVGKEDERRMGRRGDREFEREREREERPRD
293-314RERERERDREPAYGRRAPLPRR
326-354RDRRDQSRERERDGGRKRRRSPSYSPVRR
361-366KSRSPR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010516  SAP18  
IPR042534  SAP18_sf  
Pfam View protein in Pfam  
PF06487  SAP18  
Amino Acid Sequences MADIKTSKPTVDREKTCPFLLRTFVRQGSFHPLTLFDASLPPPSDEYALYTWRDTTLKELALLLRGAVAEGAGKSALARWSFRVVFPDQRGRVGSRELGFVHARELGSWKTEEGEKEKEGEEPSSAAREKRLNLTPDDRTLEELRVVPGDILSVAVLTPHTGRQASGGVGRGAGRGTGMVQGVRGAEPWAGLGGGRGADQASWRGGRGGPGAAVGRGVGRGVGKEDERRMGRRGDREFEREREREERPRDRADYGREPERDTDFGRPGKERDTEREHGISPTRELDYGRDRERERERERDREPAYGRRAPLPRRERDDVDMDDDRRDRRDQSRERERDGGRKRRRSPSYSPVRRDSTSLSKSRSPRKDSRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.64
4 0.63
5 0.56
6 0.5
7 0.52
8 0.49
9 0.47
10 0.51
11 0.52
12 0.48
13 0.45
14 0.43
15 0.46
16 0.43
17 0.38
18 0.31
19 0.28
20 0.29
21 0.3
22 0.27
23 0.17
24 0.18
25 0.17
26 0.21
27 0.22
28 0.19
29 0.19
30 0.19
31 0.2
32 0.17
33 0.2
34 0.18
35 0.2
36 0.2
37 0.2
38 0.2
39 0.21
40 0.22
41 0.18
42 0.2
43 0.21
44 0.21
45 0.21
46 0.22
47 0.2
48 0.21
49 0.21
50 0.16
51 0.12
52 0.11
53 0.1
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.08
63 0.12
64 0.13
65 0.14
66 0.16
67 0.22
68 0.24
69 0.25
70 0.27
71 0.27
72 0.33
73 0.38
74 0.45
75 0.4
76 0.41
77 0.43
78 0.41
79 0.39
80 0.35
81 0.34
82 0.25
83 0.27
84 0.24
85 0.26
86 0.25
87 0.22
88 0.21
89 0.18
90 0.17
91 0.14
92 0.17
93 0.14
94 0.15
95 0.15
96 0.14
97 0.13
98 0.15
99 0.17
100 0.19
101 0.23
102 0.21
103 0.23
104 0.23
105 0.24
106 0.24
107 0.22
108 0.18
109 0.14
110 0.14
111 0.17
112 0.18
113 0.15
114 0.18
115 0.2
116 0.21
117 0.27
118 0.32
119 0.3
120 0.33
121 0.38
122 0.37
123 0.37
124 0.38
125 0.32
126 0.3
127 0.29
128 0.26
129 0.22
130 0.2
131 0.16
132 0.14
133 0.13
134 0.1
135 0.08
136 0.07
137 0.05
138 0.05
139 0.04
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.05
147 0.07
148 0.07
149 0.07
150 0.08
151 0.09
152 0.1
153 0.11
154 0.12
155 0.1
156 0.11
157 0.11
158 0.1
159 0.09
160 0.08
161 0.06
162 0.04
163 0.05
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.07
170 0.07
171 0.06
172 0.05
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.03
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.05
187 0.06
188 0.07
189 0.07
190 0.07
191 0.08
192 0.09
193 0.1
194 0.11
195 0.1
196 0.08
197 0.09
198 0.1
199 0.09
200 0.08
201 0.07
202 0.06
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.07
209 0.09
210 0.1
211 0.14
212 0.16
213 0.21
214 0.23
215 0.26
216 0.27
217 0.31
218 0.35
219 0.4
220 0.43
221 0.43
222 0.45
223 0.49
224 0.52
225 0.51
226 0.54
227 0.47
228 0.47
229 0.46
230 0.47
231 0.49
232 0.54
233 0.57
234 0.55
235 0.6
236 0.59
237 0.57
238 0.57
239 0.56
240 0.55
241 0.51
242 0.53
243 0.48
244 0.47
245 0.46
246 0.44
247 0.39
248 0.32
249 0.33
250 0.31
251 0.32
252 0.33
253 0.33
254 0.31
255 0.33
256 0.37
257 0.35
258 0.37
259 0.42
260 0.42
261 0.44
262 0.45
263 0.41
264 0.39
265 0.4
266 0.35
267 0.28
268 0.28
269 0.25
270 0.23
271 0.23
272 0.24
273 0.28
274 0.33
275 0.35
276 0.38
277 0.39
278 0.46
279 0.54
280 0.6
281 0.58
282 0.62
283 0.64
284 0.67
285 0.69
286 0.71
287 0.64
288 0.63
289 0.61
290 0.59
291 0.6
292 0.56
293 0.55
294 0.53
295 0.58
296 0.56
297 0.62
298 0.62
299 0.63
300 0.66
301 0.7
302 0.66
303 0.64
304 0.64
305 0.57
306 0.54
307 0.51
308 0.44
309 0.43
310 0.42
311 0.39
312 0.37
313 0.37
314 0.36
315 0.39
316 0.48
317 0.53
318 0.6
319 0.7
320 0.73
321 0.76
322 0.79
323 0.75
324 0.75
325 0.76
326 0.76
327 0.76
328 0.79
329 0.82
330 0.84
331 0.88
332 0.85
333 0.84
334 0.83
335 0.84
336 0.84
337 0.83
338 0.8
339 0.77
340 0.71
341 0.66
342 0.62
343 0.61
344 0.59
345 0.59
346 0.56
347 0.58
348 0.65
349 0.72
350 0.74
351 0.73